Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5THY1

Protein Details
Accession A0A2N5THY1    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
162-189QTINSYSPRAKNKPPKIKPRVRFGDPSQHydrophilic
NLS Segment(s)
PositionSequence
170-181RAKNKPPKIKPR
Subcellular Location(s) nucl 9, cyto_mito 8, mito 7, cyto 7, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008728  Elongator_complex_protein_4  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0033588  C:elongator holoenzyme complex  
GO:0005634  C:nucleus  
GO:0002098  P:tRNA wobble uridine modification  
Pfam View protein in Pfam  
PF05625  PAXNEB  
Amino Acid Sequences MIFRFLQELEALLRAPDSAKIAFISFPGAYRSSDLAKMLPWATSASLSLQSFAGDEKSQAAFPNHQGAVHFIRLPSPSSLSPPATKLSVIRALAGPSEAGIGSNLGFKLGRRKGFRIEMMGLGLDLENENPAPAAEDEEEPPASHKHHPHPSAAQNADQNPQTINSYSPRAKNKPPKIKPRVRFGDPSQDSHDVLKNTDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.12
5 0.11
6 0.12
7 0.13
8 0.14
9 0.14
10 0.13
11 0.15
12 0.12
13 0.13
14 0.15
15 0.15
16 0.15
17 0.17
18 0.19
19 0.18
20 0.2
21 0.2
22 0.17
23 0.17
24 0.19
25 0.17
26 0.15
27 0.13
28 0.12
29 0.12
30 0.12
31 0.12
32 0.11
33 0.14
34 0.14
35 0.14
36 0.13
37 0.12
38 0.12
39 0.12
40 0.12
41 0.08
42 0.09
43 0.1
44 0.11
45 0.11
46 0.13
47 0.15
48 0.15
49 0.17
50 0.23
51 0.21
52 0.2
53 0.2
54 0.21
55 0.23
56 0.22
57 0.21
58 0.14
59 0.16
60 0.17
61 0.18
62 0.16
63 0.15
64 0.14
65 0.17
66 0.2
67 0.2
68 0.2
69 0.2
70 0.2
71 0.18
72 0.18
73 0.15
74 0.15
75 0.18
76 0.17
77 0.16
78 0.15
79 0.15
80 0.14
81 0.14
82 0.1
83 0.05
84 0.06
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.15
96 0.19
97 0.25
98 0.28
99 0.31
100 0.36
101 0.4
102 0.42
103 0.37
104 0.34
105 0.28
106 0.25
107 0.23
108 0.17
109 0.12
110 0.1
111 0.06
112 0.05
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.05
121 0.08
122 0.08
123 0.1
124 0.11
125 0.13
126 0.14
127 0.12
128 0.14
129 0.13
130 0.15
131 0.19
132 0.24
133 0.31
134 0.4
135 0.42
136 0.45
137 0.51
138 0.54
139 0.57
140 0.53
141 0.48
142 0.43
143 0.43
144 0.42
145 0.36
146 0.31
147 0.23
148 0.22
149 0.21
150 0.17
151 0.18
152 0.18
153 0.24
154 0.28
155 0.35
156 0.42
157 0.46
158 0.56
159 0.64
160 0.72
161 0.76
162 0.82
163 0.86
164 0.88
165 0.92
166 0.89
167 0.89
168 0.87
169 0.82
170 0.8
171 0.74
172 0.75
173 0.68
174 0.65
175 0.61
176 0.55
177 0.5
178 0.46
179 0.46
180 0.36