Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5T2M9

Protein Details
Accession A0A2N5T2M9   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
156-182AGKADPQQAKKPQKKARRSPRDGVAVAHydrophilic
NLS Segment(s)
PositionSequence
161-176PQQAKKPQKKARRSPR
Subcellular Location(s) cyto 14, nucl 6, mito 6, mito_nucl 6
Family & Domain DBs
Amino Acid Sequences MEASIKKIRQDNPNVKENLPFVKMHEVLNISHHADKPNPNSSDPKFLKVGNELDAEAQKEGPLAVPTVKTKNPVGVLKIQICAKNPAVKMVNKASAVPNDVGRKKTLKTKNGSNCPKSHPGDEDWDHIEARGAAFFAAHWEAQERNGKLKLKSTFAGKADPQQAKKPQKKARRSPRDGVAVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.63
3 0.6
4 0.53
5 0.48
6 0.4
7 0.34
8 0.28
9 0.33
10 0.34
11 0.3
12 0.31
13 0.27
14 0.25
15 0.28
16 0.28
17 0.22
18 0.24
19 0.25
20 0.24
21 0.27
22 0.33
23 0.36
24 0.42
25 0.41
26 0.41
27 0.46
28 0.46
29 0.53
30 0.47
31 0.45
32 0.38
33 0.37
34 0.37
35 0.34
36 0.33
37 0.25
38 0.25
39 0.21
40 0.21
41 0.21
42 0.19
43 0.15
44 0.13
45 0.1
46 0.09
47 0.08
48 0.08
49 0.07
50 0.07
51 0.07
52 0.09
53 0.12
54 0.15
55 0.16
56 0.18
57 0.18
58 0.21
59 0.24
60 0.24
61 0.24
62 0.25
63 0.28
64 0.26
65 0.28
66 0.27
67 0.25
68 0.24
69 0.25
70 0.23
71 0.24
72 0.23
73 0.25
74 0.26
75 0.25
76 0.28
77 0.27
78 0.29
79 0.24
80 0.25
81 0.22
82 0.2
83 0.2
84 0.17
85 0.18
86 0.2
87 0.22
88 0.22
89 0.23
90 0.24
91 0.23
92 0.33
93 0.37
94 0.39
95 0.42
96 0.51
97 0.59
98 0.67
99 0.74
100 0.7
101 0.65
102 0.63
103 0.66
104 0.59
105 0.52
106 0.45
107 0.38
108 0.41
109 0.39
110 0.36
111 0.3
112 0.29
113 0.26
114 0.23
115 0.21
116 0.14
117 0.12
118 0.09
119 0.07
120 0.05
121 0.05
122 0.05
123 0.07
124 0.09
125 0.08
126 0.08
127 0.1
128 0.11
129 0.15
130 0.23
131 0.22
132 0.25
133 0.31
134 0.36
135 0.36
136 0.43
137 0.43
138 0.4
139 0.42
140 0.42
141 0.43
142 0.41
143 0.45
144 0.39
145 0.43
146 0.47
147 0.52
148 0.5
149 0.51
150 0.6
151 0.65
152 0.72
153 0.75
154 0.76
155 0.79
156 0.86
157 0.89
158 0.9
159 0.9
160 0.9
161 0.88
162 0.87