Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5VK71

Protein Details
Accession A0A2N5VK71    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
50-79SSGPAPPIPHHRRRRHRHHHQPTKHHTLTTBasic
NLS Segment(s)
PositionSequence
59-67HHRRRRHRH
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MALISTTTSPAAADVYPSFADHPLGPSRPSPIDSWTRIDHVPQSNQLLSSSGPAPPIPHHRRRRHRHHHQPTKHHTLTTLNTAINV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.12
3 0.12
4 0.13
5 0.13
6 0.12
7 0.14
8 0.11
9 0.15
10 0.16
11 0.17
12 0.18
13 0.18
14 0.21
15 0.21
16 0.23
17 0.2
18 0.21
19 0.25
20 0.26
21 0.29
22 0.27
23 0.28
24 0.26
25 0.26
26 0.27
27 0.24
28 0.24
29 0.22
30 0.23
31 0.21
32 0.21
33 0.2
34 0.16
35 0.12
36 0.12
37 0.11
38 0.09
39 0.09
40 0.09
41 0.1
42 0.13
43 0.23
44 0.3
45 0.39
46 0.49
47 0.59
48 0.7
49 0.79
50 0.87
51 0.88
52 0.91
53 0.93
54 0.94
55 0.94
56 0.94
57 0.94
58 0.92
59 0.92
60 0.83
61 0.72
62 0.63
63 0.58
64 0.52
65 0.49
66 0.44