Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NXZ1

Protein Details
Accession J3NXZ1    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-39GGGLRLKGAKVKKHKKKSKDKSAAADRLDBasic
NLS Segment(s)
PositionSequence
15-32RLKGAKVKKHKKKSKDKS
Subcellular Location(s) nucl 13.5, cyto_nucl 11, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MAGDDYTVAGGGGLRLKGAKVKKHKKKSKDKSAAADRLDKALSSGDAAAAAAAADDDEAAKALVVGSAGKESSRKDGGEEDDDGAQPVQYKTEAQRRFEEAKRKKLLEMAESAAARPELLKTHKERVEQLNTYLSKLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.1
4 0.16
5 0.23
6 0.31
7 0.39
8 0.5
9 0.61
10 0.72
11 0.81
12 0.86
13 0.91
14 0.93
15 0.93
16 0.93
17 0.9
18 0.88
19 0.89
20 0.86
21 0.77
22 0.74
23 0.63
24 0.54
25 0.47
26 0.37
27 0.27
28 0.2
29 0.17
30 0.11
31 0.1
32 0.07
33 0.07
34 0.07
35 0.06
36 0.04
37 0.04
38 0.03
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.04
56 0.04
57 0.06
58 0.07
59 0.1
60 0.12
61 0.12
62 0.13
63 0.15
64 0.18
65 0.19
66 0.19
67 0.16
68 0.15
69 0.15
70 0.14
71 0.11
72 0.09
73 0.08
74 0.07
75 0.07
76 0.07
77 0.08
78 0.12
79 0.22
80 0.26
81 0.28
82 0.32
83 0.37
84 0.42
85 0.47
86 0.53
87 0.52
88 0.57
89 0.61
90 0.59
91 0.54
92 0.52
93 0.5
94 0.43
95 0.38
96 0.31
97 0.29
98 0.27
99 0.26
100 0.23
101 0.2
102 0.16
103 0.13
104 0.11
105 0.12
106 0.15
107 0.22
108 0.26
109 0.36
110 0.4
111 0.43
112 0.48
113 0.51
114 0.57
115 0.53
116 0.51
117 0.5
118 0.46
119 0.45
120 0.4
121 0.32
122 0.25
123 0.24
124 0.24
125 0.23
126 0.25
127 0.3
128 0.34
129 0.36