Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5VZX7

Protein Details
Accession A0A2N5VZX7    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-58PKAKKSTKPADGEKKKKRTKRKEITSKLAMYBasic
NLS Segment(s)
PositionSequence
11-50KPASTASKAPASKPAAEPKAKKSTKPADGEKKKKRTKRKE
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MPPKSTTAEKKPASTASKAPASKPAAEPKAKKSTKPADGEKKKKRTKRKEITSKLAMYNKRSTISSREIQTAVRLILPGELSKHAISEGTKGVTKYTSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.42
4 0.48
5 0.45
6 0.43
7 0.43
8 0.42
9 0.42
10 0.42
11 0.45
12 0.43
13 0.49
14 0.51
15 0.51
16 0.58
17 0.56
18 0.53
19 0.53
20 0.55
21 0.56
22 0.59
23 0.61
24 0.61
25 0.7
26 0.79
27 0.8
28 0.81
29 0.82
30 0.83
31 0.85
32 0.85
33 0.86
34 0.86
35 0.88
36 0.88
37 0.88
38 0.87
39 0.82
40 0.74
41 0.68
42 0.63
43 0.55
44 0.48
45 0.46
46 0.4
47 0.35
48 0.33
49 0.3
50 0.3
51 0.32
52 0.32
53 0.29
54 0.3
55 0.3
56 0.29
57 0.29
58 0.25
59 0.2
60 0.15
61 0.13
62 0.11
63 0.11
64 0.12
65 0.11
66 0.11
67 0.12
68 0.14
69 0.14
70 0.14
71 0.13
72 0.14
73 0.14
74 0.15
75 0.17
76 0.17
77 0.2
78 0.2
79 0.21
80 0.21