Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3PHS7

Protein Details
Accession J3PHS7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
41-60LRVVRSRLGRRHSRRAHPIWBasic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 8.833, extr 6, cyto 5, cyto_mito 4.333, mito 2.5
Family & Domain DBs
Amino Acid Sequences MSPWIESIPHEVLSHIRNSNHSNVAACLLLAIAEQCVRSVLRVVRSRLGRRHSRRAHPIWLELNPSQSRDSAASILTEFVPEIAVTNLGDNKQLRERASRSKNAKLRGLSSDVIFAPLAIVLGSGLAQSAPQPQARCYNNQIIPPFSQLPWLVIGPDWRAEDPEAALRNAVSTSCGTVNTWRWSRSSEDPNGFTVEFDLRGQWTAAAGRVACREPSPLPESCIITSCAYHDEDMGMGGDCQWKTRNGKQEKIDWHPLHKACFRRRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.26
4 0.29
5 0.34
6 0.39
7 0.39
8 0.38
9 0.33
10 0.3
11 0.3
12 0.25
13 0.2
14 0.14
15 0.1
16 0.08
17 0.07
18 0.06
19 0.05
20 0.06
21 0.06
22 0.06
23 0.08
24 0.08
25 0.09
26 0.14
27 0.17
28 0.25
29 0.32
30 0.35
31 0.41
32 0.49
33 0.56
34 0.58
35 0.63
36 0.65
37 0.67
38 0.74
39 0.76
40 0.78
41 0.81
42 0.79
43 0.8
44 0.72
45 0.7
46 0.64
47 0.57
48 0.53
49 0.43
50 0.44
51 0.36
52 0.34
53 0.29
54 0.24
55 0.24
56 0.2
57 0.21
58 0.15
59 0.14
60 0.13
61 0.12
62 0.13
63 0.11
64 0.09
65 0.07
66 0.06
67 0.06
68 0.05
69 0.06
70 0.05
71 0.05
72 0.05
73 0.07
74 0.08
75 0.08
76 0.12
77 0.11
78 0.14
79 0.18
80 0.21
81 0.22
82 0.27
83 0.31
84 0.38
85 0.45
86 0.51
87 0.52
88 0.58
89 0.61
90 0.6
91 0.61
92 0.53
93 0.49
94 0.44
95 0.42
96 0.34
97 0.29
98 0.26
99 0.2
100 0.19
101 0.16
102 0.12
103 0.08
104 0.07
105 0.06
106 0.04
107 0.04
108 0.02
109 0.02
110 0.03
111 0.02
112 0.02
113 0.02
114 0.02
115 0.03
116 0.06
117 0.08
118 0.1
119 0.1
120 0.12
121 0.2
122 0.21
123 0.24
124 0.26
125 0.32
126 0.33
127 0.36
128 0.36
129 0.31
130 0.3
131 0.3
132 0.28
133 0.2
134 0.19
135 0.16
136 0.15
137 0.14
138 0.13
139 0.1
140 0.09
141 0.11
142 0.09
143 0.11
144 0.11
145 0.1
146 0.11
147 0.11
148 0.11
149 0.11
150 0.14
151 0.14
152 0.13
153 0.13
154 0.11
155 0.11
156 0.11
157 0.1
158 0.07
159 0.06
160 0.08
161 0.08
162 0.09
163 0.09
164 0.13
165 0.18
166 0.24
167 0.26
168 0.26
169 0.26
170 0.28
171 0.33
172 0.36
173 0.39
174 0.4
175 0.42
176 0.42
177 0.43
178 0.43
179 0.38
180 0.3
181 0.24
182 0.18
183 0.14
184 0.13
185 0.12
186 0.1
187 0.11
188 0.11
189 0.09
190 0.09
191 0.09
192 0.1
193 0.11
194 0.1
195 0.12
196 0.15
197 0.16
198 0.16
199 0.16
200 0.18
201 0.18
202 0.24
203 0.26
204 0.24
205 0.26
206 0.28
207 0.31
208 0.28
209 0.28
210 0.25
211 0.22
212 0.21
213 0.19
214 0.19
215 0.17
216 0.17
217 0.15
218 0.13
219 0.12
220 0.12
221 0.11
222 0.09
223 0.07
224 0.08
225 0.13
226 0.13
227 0.15
228 0.17
229 0.22
230 0.29
231 0.37
232 0.46
233 0.5
234 0.58
235 0.62
236 0.69
237 0.71
238 0.72
239 0.76
240 0.69
241 0.66
242 0.68
243 0.65
244 0.64
245 0.62
246 0.63