Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5W291

Protein Details
Accession A0A2N5W291    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-33YVPGRCRRDQPGKRRSRSMKBasic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
Amino Acid Sequences MPEVVFHLKAFSPYVPGRCRRDQPGKRRSRSMKSCCSRIPAPLNDLVYYDLYMRAGALICYEAAGGSVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.39
4 0.44
5 0.49
6 0.54
7 0.57
8 0.64
9 0.66
10 0.71
11 0.74
12 0.78
13 0.76
14 0.8
15 0.79
16 0.78
17 0.79
18 0.76
19 0.76
20 0.7
21 0.71
22 0.63
23 0.61
24 0.52
25 0.47
26 0.46
27 0.37
28 0.36
29 0.34
30 0.34
31 0.29
32 0.28
33 0.24
34 0.18
35 0.16
36 0.13
37 0.1
38 0.09
39 0.09
40 0.08
41 0.07
42 0.07
43 0.06
44 0.06
45 0.07
46 0.06
47 0.07
48 0.07
49 0.06