Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5U0G8

Protein Details
Accession A0A2N5U0G8   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
32-65KTKSQPSQTNNSKKKPSKPKNKKGAKSDNTNEDEHydrophilic
NLS Segment(s)
PositionSequence
44-57KKKPSKPKNKKGAK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029466  NAM-associated_C  
Pfam View protein in Pfam  
PF14303  NAM-associated  
Amino Acid Sequences MASTTLDPKLFTLDVDSFESPTPQKDDLDEGKTKSQPSQTNNSKKKPSKPKNKKGAKSDNTNEDEEKDNKPKSQKPPNWCIEKDQALCTSWLNTLKDAIVGSNQTKSTFWDCIHQMYLGLMEETVEKNKSKKGFKAFPTRLKGALENCWYTIQQLVGKFCGFYAQVKRRLCSGANHDNIMVEARLLFRTDTGKVFNLEHAWGILCYSAKWMKNLDEANGCGKSKAKNASIDVNDASTNPLTDPPSSNTNGPPSNATTPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.25
4 0.22
5 0.22
6 0.25
7 0.21
8 0.23
9 0.24
10 0.21
11 0.22
12 0.22
13 0.29
14 0.31
15 0.36
16 0.37
17 0.36
18 0.4
19 0.43
20 0.42
21 0.4
22 0.42
23 0.43
24 0.45
25 0.52
26 0.56
27 0.65
28 0.72
29 0.76
30 0.78
31 0.79
32 0.83
33 0.84
34 0.85
35 0.85
36 0.88
37 0.9
38 0.9
39 0.94
40 0.92
41 0.91
42 0.92
43 0.88
44 0.86
45 0.82
46 0.81
47 0.74
48 0.68
49 0.58
50 0.49
51 0.46
52 0.39
53 0.38
54 0.36
55 0.34
56 0.36
57 0.42
58 0.48
59 0.53
60 0.61
61 0.63
62 0.64
63 0.72
64 0.76
65 0.77
66 0.7
67 0.66
68 0.61
69 0.61
70 0.54
71 0.47
72 0.41
73 0.33
74 0.33
75 0.27
76 0.22
77 0.17
78 0.2
79 0.18
80 0.17
81 0.16
82 0.16
83 0.16
84 0.14
85 0.12
86 0.08
87 0.1
88 0.1
89 0.12
90 0.13
91 0.13
92 0.13
93 0.15
94 0.17
95 0.18
96 0.17
97 0.19
98 0.2
99 0.21
100 0.22
101 0.19
102 0.16
103 0.13
104 0.13
105 0.08
106 0.07
107 0.05
108 0.04
109 0.05
110 0.06
111 0.07
112 0.08
113 0.08
114 0.1
115 0.14
116 0.19
117 0.22
118 0.27
119 0.34
120 0.4
121 0.46
122 0.56
123 0.6
124 0.62
125 0.64
126 0.61
127 0.54
128 0.48
129 0.44
130 0.35
131 0.34
132 0.29
133 0.24
134 0.23
135 0.22
136 0.21
137 0.19
138 0.17
139 0.13
140 0.12
141 0.14
142 0.14
143 0.14
144 0.14
145 0.14
146 0.12
147 0.13
148 0.11
149 0.13
150 0.21
151 0.27
152 0.36
153 0.37
154 0.38
155 0.39
156 0.41
157 0.39
158 0.35
159 0.36
160 0.37
161 0.38
162 0.38
163 0.36
164 0.33
165 0.31
166 0.27
167 0.18
168 0.08
169 0.07
170 0.07
171 0.07
172 0.08
173 0.08
174 0.08
175 0.11
176 0.13
177 0.14
178 0.16
179 0.17
180 0.18
181 0.19
182 0.2
183 0.19
184 0.18
185 0.16
186 0.14
187 0.13
188 0.11
189 0.1
190 0.09
191 0.08
192 0.07
193 0.12
194 0.17
195 0.18
196 0.2
197 0.23
198 0.24
199 0.31
200 0.32
201 0.31
202 0.3
203 0.3
204 0.33
205 0.34
206 0.32
207 0.26
208 0.28
209 0.28
210 0.3
211 0.36
212 0.36
213 0.38
214 0.42
215 0.5
216 0.49
217 0.49
218 0.43
219 0.37
220 0.33
221 0.27
222 0.26
223 0.18
224 0.16
225 0.13
226 0.16
227 0.16
228 0.18
229 0.22
230 0.23
231 0.28
232 0.3
233 0.32
234 0.33
235 0.38
236 0.38
237 0.36
238 0.36
239 0.36