Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5S5A0

Protein Details
Accession A0A2N5S5A0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
14-35AARPKGMRTPPRTPKKKACGGCHydrophilic
NLS Segment(s)
PositionSequence
17-30PKGMRTPPRTPKKK
Subcellular Location(s) mito 27
Family & Domain DBs
Amino Acid Sequences MRHVHKVAHWGLIAARPKGMRTPPRTPKKKACGGCTPSHTGVQTPARPPPHAARRPHTYKWREDSRLGVRPRRTGVLAMHACLEGVQALHALRTGVHGVELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.23
4 0.24
5 0.29
6 0.36
7 0.39
8 0.42
9 0.52
10 0.59
11 0.7
12 0.76
13 0.79
14 0.81
15 0.81
16 0.82
17 0.77
18 0.74
19 0.73
20 0.71
21 0.68
22 0.62
23 0.59
24 0.51
25 0.47
26 0.4
27 0.3
28 0.3
29 0.29
30 0.28
31 0.24
32 0.27
33 0.28
34 0.28
35 0.3
36 0.33
37 0.38
38 0.42
39 0.44
40 0.45
41 0.51
42 0.57
43 0.61
44 0.63
45 0.58
46 0.58
47 0.61
48 0.64
49 0.6
50 0.55
51 0.56
52 0.53
53 0.57
54 0.55
55 0.54
56 0.49
57 0.5
58 0.51
59 0.46
60 0.4
61 0.35
62 0.32
63 0.35
64 0.32
65 0.28
66 0.27
67 0.23
68 0.22
69 0.19
70 0.17
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.07
79 0.07
80 0.09
81 0.11
82 0.09