Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5T3R2

Protein Details
Accession A0A2N5T3R2   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
61-99VCFLRDKRRASRQHTSKKHHKEHHKPHRKPKPSTRDLRDBasic
NLS Segment(s)
PositionSequence
67-95KRRASRQHTSKKHHKEHHKPHRKPKPSTR
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MDSLLSPPLNIQLLETSSANSYDEVQKSLSACLNNHDLLPYVIGGNTIQIKNHLYKIRDEVCFLRDKRRASRQHTSKKHHKEHHKPHRKPKPSTRDLRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.14
4 0.14
5 0.14
6 0.14
7 0.12
8 0.13
9 0.16
10 0.17
11 0.17
12 0.17
13 0.18
14 0.18
15 0.19
16 0.2
17 0.16
18 0.15
19 0.17
20 0.2
21 0.19
22 0.18
23 0.16
24 0.14
25 0.12
26 0.13
27 0.1
28 0.06
29 0.06
30 0.06
31 0.05
32 0.06
33 0.09
34 0.08
35 0.08
36 0.09
37 0.11
38 0.12
39 0.17
40 0.2
41 0.19
42 0.21
43 0.27
44 0.31
45 0.3
46 0.31
47 0.27
48 0.26
49 0.32
50 0.31
51 0.34
52 0.35
53 0.38
54 0.44
55 0.53
56 0.59
57 0.6
58 0.7
59 0.71
60 0.77
61 0.83
62 0.84
63 0.85
64 0.87
65 0.89
66 0.88
67 0.88
68 0.88
69 0.9
70 0.92
71 0.93
72 0.92
73 0.93
74 0.94
75 0.93
76 0.92
77 0.92
78 0.91
79 0.91