Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5SM48

Protein Details
Accession A0A2N5SM48   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
23-51LHQRRARSKGRSHCRARCRSCRQFRNPTDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, cyto 5, mito 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MDRSPVKAAFPLEFSCTISVLALHQRRARSKGRSHCRARCRSCRQFRNPTDVLSVDGGSNGIVAGAVCCAIHQGLDWNNETLPYHRQAHSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.19
4 0.17
5 0.14
6 0.13
7 0.11
8 0.18
9 0.2
10 0.24
11 0.27
12 0.31
13 0.35
14 0.41
15 0.46
16 0.46
17 0.52
18 0.58
19 0.65
20 0.7
21 0.75
22 0.78
23 0.8
24 0.83
25 0.82
26 0.82
27 0.82
28 0.82
29 0.84
30 0.85
31 0.84
32 0.84
33 0.78
34 0.76
35 0.67
36 0.58
37 0.5
38 0.41
39 0.33
40 0.24
41 0.21
42 0.12
43 0.11
44 0.09
45 0.07
46 0.06
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.04
58 0.04
59 0.04
60 0.09
61 0.14
62 0.18
63 0.2
64 0.2
65 0.2
66 0.21
67 0.23
68 0.2
69 0.21
70 0.23
71 0.26