Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P7K4

Protein Details
Accession J3P7K4   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
62-90SPRQGLKAESRRPRRRSRMQTEASRRRSAHydrophilic
NLS Segment(s)
PositionSequence
68-95KAESRRPRRRSRMQTEASRRRSARGPGR
Subcellular Location(s) cyto_nucl 10.5, nucl 10, cyto 9, mito 8
Family & Domain DBs
Amino Acid Sequences MRHSKEGAGQELAPTLFPPPDATMGAVVGSRSIYHNAGNGGGGGGGGGVAPEMGIVVAVGVSPRQGLKAESRRPRRRSRMQTEASRRRSARGPGRQLSAGTDEVSRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.1
4 0.1
5 0.12
6 0.11
7 0.13
8 0.14
9 0.14
10 0.13
11 0.13
12 0.13
13 0.11
14 0.09
15 0.07
16 0.06
17 0.06
18 0.07
19 0.09
20 0.1
21 0.1
22 0.12
23 0.12
24 0.12
25 0.11
26 0.1
27 0.08
28 0.06
29 0.06
30 0.04
31 0.03
32 0.02
33 0.02
34 0.02
35 0.02
36 0.01
37 0.01
38 0.01
39 0.02
40 0.01
41 0.01
42 0.01
43 0.01
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.03
50 0.03
51 0.04
52 0.05
53 0.07
54 0.15
55 0.25
56 0.34
57 0.43
58 0.55
59 0.64
60 0.71
61 0.8
62 0.81
63 0.83
64 0.85
65 0.85
66 0.85
67 0.83
68 0.86
69 0.87
70 0.87
71 0.83
72 0.8
73 0.71
74 0.65
75 0.62
76 0.62
77 0.61
78 0.61
79 0.64
80 0.61
81 0.65
82 0.63
83 0.58
84 0.51
85 0.45
86 0.36
87 0.28
88 0.25