Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5U4C7

Protein Details
Accession A0A2N5U4C7    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
51-81RDEGRDKDRQKDRKKEREKKRENDCKNDREKBasic
114-167RENDREKYQKRGRKKERKNDRKKERERGHEKERVKDRDKDRKDREKGREMEREKBasic
NLS Segment(s)
PositionSequence
28-108HGRGRRNAKIGARKTAEVKHEEERDEGRDKDRQKDRKKEREKKRENDCKNDREKERENGRKKEREKEREKEREREREKERE
116-168NDREKYQKRGRKKERKNDRKKERERGHEKERVKDRDKDRKDREKGREMEREKR
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MHGDQHSQRLVKGWQPSPKAESWREIEHGRGRRNAKIGARKTAEVKHEEERDEGRDKDRQKDRKKEREKKRENDCKNDREKERENGRKKEREKEREKEREREREKERENACEERENDREKYQKRGRKKERKNDRKKERERGHEKERVKDRDKDRKDREKGREMEREKRENVEKHCASGVIQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.51
4 0.52
5 0.54
6 0.56
7 0.51
8 0.5
9 0.46
10 0.46
11 0.46
12 0.42
13 0.43
14 0.44
15 0.49
16 0.48
17 0.51
18 0.5
19 0.51
20 0.54
21 0.54
22 0.54
23 0.56
24 0.56
25 0.57
26 0.57
27 0.54
28 0.54
29 0.53
30 0.5
31 0.43
32 0.42
33 0.4
34 0.4
35 0.39
36 0.37
37 0.34
38 0.34
39 0.34
40 0.32
41 0.28
42 0.3
43 0.32
44 0.39
45 0.46
46 0.52
47 0.58
48 0.67
49 0.74
50 0.8
51 0.88
52 0.89
53 0.91
54 0.92
55 0.93
56 0.91
57 0.91
58 0.91
59 0.86
60 0.87
61 0.84
62 0.81
63 0.79
64 0.78
65 0.7
66 0.67
67 0.65
68 0.63
69 0.65
70 0.66
71 0.66
72 0.68
73 0.72
74 0.73
75 0.72
76 0.73
77 0.73
78 0.73
79 0.73
80 0.73
81 0.75
82 0.77
83 0.79
84 0.78
85 0.76
86 0.76
87 0.73
88 0.72
89 0.68
90 0.67
91 0.65
92 0.64
93 0.58
94 0.54
95 0.54
96 0.49
97 0.45
98 0.42
99 0.41
100 0.37
101 0.4
102 0.38
103 0.36
104 0.36
105 0.42
106 0.38
107 0.46
108 0.5
109 0.53
110 0.6
111 0.69
112 0.76
113 0.79
114 0.88
115 0.88
116 0.91
117 0.94
118 0.95
119 0.95
120 0.95
121 0.95
122 0.94
123 0.94
124 0.92
125 0.92
126 0.9
127 0.88
128 0.86
129 0.83
130 0.77
131 0.76
132 0.76
133 0.74
134 0.7
135 0.7
136 0.71
137 0.74
138 0.79
139 0.8
140 0.81
141 0.83
142 0.87
143 0.88
144 0.87
145 0.86
146 0.84
147 0.82
148 0.82
149 0.77
150 0.78
151 0.77
152 0.75
153 0.67
154 0.68
155 0.68
156 0.65
157 0.65
158 0.66
159 0.58
160 0.54
161 0.53
162 0.46