Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3NUF8

Protein Details
Accession J3NUF8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
29-51PRGASRWRTRWARRSGRGGKRGWBasic
NLS Segment(s)
PositionSequence
24-53AAKAVPRGASRWRTRWARRSGRGGKRGWRE
Subcellular Location(s) mito 19, cyto 4, extr 3
Family & Domain DBs
Amino Acid Sequences MTAQLHAHMAPRGISRQNEGGHGAAKAVPRGASRWRTRWARRSGRGGKRGWREDGWEGRGSEARAGKDDNPAPVLAVLSAGSAACSIGRLDETLARAAGAAARPSVVAPTGACGHDPEEVAVARRAETSNAGPACLHSAVSAGFTGAFGPRRQPIGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.34
4 0.35
5 0.34
6 0.34
7 0.3
8 0.26
9 0.24
10 0.21
11 0.17
12 0.17
13 0.16
14 0.15
15 0.15
16 0.14
17 0.18
18 0.25
19 0.31
20 0.36
21 0.41
22 0.49
23 0.56
24 0.64
25 0.71
26 0.73
27 0.75
28 0.75
29 0.8
30 0.82
31 0.82
32 0.81
33 0.76
34 0.74
35 0.73
36 0.71
37 0.65
38 0.55
39 0.5
40 0.49
41 0.5
42 0.45
43 0.39
44 0.34
45 0.31
46 0.32
47 0.28
48 0.25
49 0.22
50 0.18
51 0.17
52 0.18
53 0.18
54 0.22
55 0.22
56 0.2
57 0.18
58 0.17
59 0.16
60 0.14
61 0.13
62 0.07
63 0.06
64 0.05
65 0.03
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.05
78 0.07
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.07
85 0.08
86 0.07
87 0.07
88 0.06
89 0.06
90 0.07
91 0.07
92 0.07
93 0.06
94 0.06
95 0.05
96 0.07
97 0.09
98 0.09
99 0.1
100 0.1
101 0.11
102 0.12
103 0.13
104 0.11
105 0.11
106 0.11
107 0.13
108 0.15
109 0.14
110 0.13
111 0.14
112 0.15
113 0.14
114 0.17
115 0.17
116 0.22
117 0.21
118 0.21
119 0.2
120 0.2
121 0.23
122 0.2
123 0.18
124 0.1
125 0.11
126 0.11
127 0.12
128 0.11
129 0.07
130 0.07
131 0.07
132 0.08
133 0.1
134 0.13
135 0.13
136 0.17
137 0.21