Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5TIP2

Protein Details
Accession A0A2N5TIP2    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
23-46LIGVDRQHHTRRRQRLRNIPFCAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSGSNRYRLTQQPATSARYCHQLIGVDRQHHTRRRQRLRNIPFCAPTHHPKYLPPTGGANPRYRPAPACQGIAPRRAGTSLYPHIEELFLAKQVKACTGLPRNNSSASWYKLVAARQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.51
3 0.47
4 0.4
5 0.39
6 0.38
7 0.3
8 0.28
9 0.27
10 0.27
11 0.34
12 0.38
13 0.35
14 0.36
15 0.42
16 0.48
17 0.5
18 0.57
19 0.56
20 0.62
21 0.69
22 0.77
23 0.8
24 0.84
25 0.87
26 0.88
27 0.84
28 0.78
29 0.71
30 0.62
31 0.57
32 0.51
33 0.48
34 0.44
35 0.41
36 0.37
37 0.35
38 0.41
39 0.41
40 0.37
41 0.32
42 0.29
43 0.29
44 0.35
45 0.35
46 0.32
47 0.28
48 0.28
49 0.28
50 0.25
51 0.24
52 0.2
53 0.26
54 0.25
55 0.25
56 0.25
57 0.32
58 0.34
59 0.36
60 0.35
61 0.26
62 0.24
63 0.23
64 0.23
65 0.17
66 0.21
67 0.22
68 0.23
69 0.23
70 0.23
71 0.23
72 0.22
73 0.2
74 0.17
75 0.12
76 0.13
77 0.13
78 0.14
79 0.16
80 0.17
81 0.19
82 0.19
83 0.19
84 0.25
85 0.32
86 0.39
87 0.41
88 0.46
89 0.47
90 0.46
91 0.45
92 0.42
93 0.41
94 0.39
95 0.36
96 0.32
97 0.31