Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5S2T6

Protein Details
Accession A0A2N5S2T6    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-67DCGQRRGRRHIPARRRHNVDSBasic
69-94AQLRTARSTLKPPKKPKNIRKSENKVHydrophilic
NLS Segment(s)
PositionSequence
52-62RGRRHIPARRR
75-93RSTLKPPKKPKNIRKSENK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences VHIPPATSKPDLDTQAGCAAVSVYPSLPGNTRTNQDLQPNQLRYAADCGQRRGRRHIPARRRHNVDSYAQLRTARSTLKPPKKPKNIRKSENKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.27
4 0.22
5 0.16
6 0.14
7 0.11
8 0.11
9 0.09
10 0.06
11 0.07
12 0.08
13 0.09
14 0.1
15 0.14
16 0.17
17 0.18
18 0.2
19 0.22
20 0.24
21 0.27
22 0.31
23 0.29
24 0.32
25 0.37
26 0.37
27 0.35
28 0.34
29 0.31
30 0.26
31 0.29
32 0.26
33 0.25
34 0.25
35 0.27
36 0.34
37 0.38
38 0.41
39 0.44
40 0.47
41 0.5
42 0.58
43 0.65
44 0.67
45 0.73
46 0.8
47 0.81
48 0.81
49 0.75
50 0.72
51 0.66
52 0.59
53 0.58
54 0.51
55 0.44
56 0.39
57 0.36
58 0.3
59 0.28
60 0.27
61 0.22
62 0.22
63 0.29
64 0.39
65 0.48
66 0.57
67 0.66
68 0.74
69 0.82
70 0.91
71 0.92
72 0.92
73 0.92
74 0.93