Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5U6G3

Protein Details
Accession A0A2N5U6G3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-51RHAQRACARPPKRLKKRRAGLHASQBasic
NLS Segment(s)
PositionSequence
35-53RPPKRLKKRRAGLHASQPG
56-69TPARPPPHAARRPH
Subcellular Location(s) mito 9, nucl 6, extr 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MSAILEQLLLMWIADLLLERISGGGDRHAQRACARPPKRLKKRRAGLHASQPGVQTPARPPPHAARRPHAYKWREDGRLGVWPRRTGVLAMHACLEGVQALHALRTGVHGWHACPARLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.05
5 0.05
6 0.04
7 0.05
8 0.05
9 0.06
10 0.06
11 0.09
12 0.15
13 0.17
14 0.21
15 0.22
16 0.24
17 0.26
18 0.33
19 0.38
20 0.43
21 0.44
22 0.49
23 0.59
24 0.69
25 0.77
26 0.79
27 0.8
28 0.81
29 0.87
30 0.87
31 0.86
32 0.82
33 0.77
34 0.77
35 0.74
36 0.64
37 0.56
38 0.47
39 0.38
40 0.32
41 0.27
42 0.18
43 0.14
44 0.21
45 0.22
46 0.22
47 0.24
48 0.3
49 0.4
50 0.45
51 0.47
52 0.44
53 0.5
54 0.55
55 0.59
56 0.6
57 0.53
58 0.51
59 0.55
60 0.57
61 0.51
62 0.46
63 0.41
64 0.34
65 0.4
66 0.38
67 0.35
68 0.31
69 0.3
70 0.3
71 0.3
72 0.29
73 0.21
74 0.2
75 0.24
76 0.22
77 0.21
78 0.21
79 0.2
80 0.19
81 0.18
82 0.16
83 0.07
84 0.06
85 0.05
86 0.06
87 0.06
88 0.06
89 0.07
90 0.07
91 0.06
92 0.1
93 0.11
94 0.1
95 0.15
96 0.16
97 0.17
98 0.24
99 0.27