Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5W1T9

Protein Details
Accession A0A2N5W1T9   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
52-105NESTHSKSKSKPRKKRPRKAASPATKNKSDVGTKKRTKTKKTKNKANQVGSDQTHydrophilic
NLS Segment(s)
PositionSequence
58-96KSKSKPRKKRPRKAASPATKNKSDVGTKKRTKTKKTKNK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MEPQTQSQTQQPKNNNLIEDSGNEGNTTDRSNSQLCRSKQALKEPGATFSDNESTHSKSKSKPRKKRPRKAASPATKNKSDVGTKKRTKTKKTKNKANQVGSDQTM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.59
3 0.51
4 0.47
5 0.39
6 0.34
7 0.3
8 0.24
9 0.2
10 0.19
11 0.17
12 0.15
13 0.14
14 0.15
15 0.11
16 0.11
17 0.14
18 0.17
19 0.18
20 0.25
21 0.33
22 0.32
23 0.38
24 0.4
25 0.45
26 0.47
27 0.54
28 0.53
29 0.47
30 0.53
31 0.46
32 0.46
33 0.4
34 0.37
35 0.28
36 0.22
37 0.24
38 0.16
39 0.19
40 0.18
41 0.19
42 0.2
43 0.22
44 0.23
45 0.25
46 0.35
47 0.44
48 0.53
49 0.6
50 0.69
51 0.79
52 0.88
53 0.93
54 0.94
55 0.94
56 0.94
57 0.93
58 0.93
59 0.92
60 0.91
61 0.9
62 0.84
63 0.77
64 0.68
65 0.6
66 0.54
67 0.51
68 0.49
69 0.48
70 0.53
71 0.57
72 0.64
73 0.72
74 0.76
75 0.79
76 0.82
77 0.85
78 0.85
79 0.89
80 0.92
81 0.92
82 0.94
83 0.94
84 0.92
85 0.88
86 0.83