Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3NKQ6

Protein Details
Accession J3NKQ6    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
87-111ALLISLKKKAKNRFRCFIRRNCLVAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MEPIVTIPTLLLIYSDKVDLVLKENFLQAHQRAPALFTLAGKARAFVINCLQLRIINKSNVGIVAFFQSRASKISNGVFNKRKISLALLISLKKKAKNRFRCFIRRNCLVALKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.09
5 0.11
6 0.11
7 0.14
8 0.14
9 0.15
10 0.15
11 0.17
12 0.17
13 0.17
14 0.22
15 0.18
16 0.2
17 0.2
18 0.2
19 0.19
20 0.2
21 0.19
22 0.16
23 0.16
24 0.11
25 0.13
26 0.13
27 0.17
28 0.15
29 0.15
30 0.13
31 0.15
32 0.15
33 0.14
34 0.16
35 0.19
36 0.19
37 0.2
38 0.19
39 0.18
40 0.19
41 0.23
42 0.22
43 0.17
44 0.17
45 0.17
46 0.17
47 0.16
48 0.14
49 0.09
50 0.07
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.1
57 0.11
58 0.13
59 0.11
60 0.14
61 0.17
62 0.24
63 0.27
64 0.35
65 0.39
66 0.4
67 0.43
68 0.42
69 0.39
70 0.33
71 0.33
72 0.3
73 0.26
74 0.27
75 0.27
76 0.29
77 0.3
78 0.35
79 0.35
80 0.36
81 0.42
82 0.47
83 0.55
84 0.63
85 0.7
86 0.74
87 0.81
88 0.86
89 0.87
90 0.87
91 0.85
92 0.82
93 0.77
94 0.72