Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5UR29

Protein Details
Accession A0A2N5UR29    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
37-65SQPKKHSAAHQNCRNRRRKQKPNCQASSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 6, cyto 2
Family & Domain DBs
Amino Acid Sequences MLAIQAGLPNHVELPERSGRLQSLWCKVLGGQASYASQPKKHSAAHQNCRNRRRKQKPNCQASSSASCRVIQGLSYIPLTHWPTSITRQFHPADVGFLKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.23
4 0.23
5 0.24
6 0.24
7 0.24
8 0.3
9 0.29
10 0.3
11 0.3
12 0.29
13 0.27
14 0.27
15 0.29
16 0.25
17 0.2
18 0.14
19 0.14
20 0.14
21 0.15
22 0.19
23 0.16
24 0.16
25 0.18
26 0.2
27 0.23
28 0.24
29 0.3
30 0.37
31 0.47
32 0.54
33 0.61
34 0.67
35 0.71
36 0.79
37 0.8
38 0.79
39 0.8
40 0.81
41 0.83
42 0.84
43 0.88
44 0.89
45 0.9
46 0.86
47 0.78
48 0.71
49 0.65
50 0.61
51 0.54
52 0.47
53 0.38
54 0.33
55 0.3
56 0.28
57 0.23
58 0.15
59 0.13
60 0.11
61 0.11
62 0.12
63 0.11
64 0.11
65 0.17
66 0.2
67 0.19
68 0.18
69 0.18
70 0.21
71 0.28
72 0.35
73 0.33
74 0.31
75 0.37
76 0.38
77 0.38
78 0.39
79 0.33
80 0.31
81 0.29