Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5VUE1

Protein Details
Accession A0A2N5VUE1    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
199-222VAEEGGPKKRRKKRKQGEMLAGSNBasic
310-335PSLFCREDDYRKKKRVKIGNPAAGKNHydrophilic
NLS Segment(s)
PositionSequence
204-213GPKKRRKKRK
321-326KKKRVK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013942  Mediator_Med19_fun  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Amino Acid Sequences MQQLNPNHPPPQAGTSNRTNPKTLFFPVIDQGHLPAAPISGSHDLLSLFNVSSVYDLYVKPYLKPLDQPNKLGNSSSTLPTNTLLPNHHHPPYHIPSTNGDLKGKGKADSDLAALSPAQVDSLGQKRNKMEKSYGHFVADVGGRNSIKKDHQLESWISDASFQEANIPNFLKPFSDDVLSQAFTLQPGIQPNFDASVWVAEEGGPKKRRKKRKQGEMLAGSNPPQAAGYPQQHARPSNPATTRAPPSHYPAGSSVPSHPTRSARSAMDPSSHLNHHHQQQQHHLPAHLHLPQHQHQHPQQQQQQQQHASPSLFCREDDYRKKKRVKIGNPAAGKNSGSGSSGPSHQVALQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.49
3 0.58
4 0.63
5 0.62
6 0.59
7 0.52
8 0.53
9 0.51
10 0.46
11 0.42
12 0.35
13 0.35
14 0.38
15 0.39
16 0.34
17 0.3
18 0.27
19 0.23
20 0.22
21 0.19
22 0.12
23 0.11
24 0.1
25 0.09
26 0.13
27 0.14
28 0.15
29 0.14
30 0.15
31 0.15
32 0.15
33 0.16
34 0.13
35 0.1
36 0.1
37 0.09
38 0.08
39 0.09
40 0.09
41 0.09
42 0.1
43 0.1
44 0.13
45 0.19
46 0.2
47 0.2
48 0.26
49 0.28
50 0.27
51 0.34
52 0.41
53 0.46
54 0.5
55 0.53
56 0.52
57 0.54
58 0.53
59 0.48
60 0.38
61 0.33
62 0.31
63 0.29
64 0.26
65 0.21
66 0.21
67 0.2
68 0.22
69 0.18
70 0.19
71 0.19
72 0.22
73 0.28
74 0.32
75 0.35
76 0.33
77 0.33
78 0.39
79 0.43
80 0.45
81 0.4
82 0.37
83 0.36
84 0.41
85 0.46
86 0.4
87 0.34
88 0.28
89 0.28
90 0.32
91 0.31
92 0.27
93 0.21
94 0.2
95 0.21
96 0.2
97 0.19
98 0.14
99 0.13
100 0.11
101 0.1
102 0.09
103 0.07
104 0.06
105 0.05
106 0.04
107 0.04
108 0.07
109 0.13
110 0.19
111 0.2
112 0.23
113 0.28
114 0.37
115 0.41
116 0.41
117 0.41
118 0.43
119 0.5
120 0.52
121 0.49
122 0.42
123 0.38
124 0.34
125 0.31
126 0.25
127 0.19
128 0.13
129 0.14
130 0.13
131 0.13
132 0.14
133 0.14
134 0.14
135 0.19
136 0.23
137 0.23
138 0.24
139 0.28
140 0.28
141 0.27
142 0.27
143 0.21
144 0.16
145 0.15
146 0.13
147 0.12
148 0.11
149 0.08
150 0.12
151 0.16
152 0.16
153 0.17
154 0.18
155 0.15
156 0.16
157 0.16
158 0.11
159 0.09
160 0.1
161 0.1
162 0.1
163 0.1
164 0.11
165 0.13
166 0.13
167 0.12
168 0.1
169 0.09
170 0.08
171 0.08
172 0.07
173 0.06
174 0.09
175 0.1
176 0.1
177 0.1
178 0.11
179 0.12
180 0.11
181 0.1
182 0.07
183 0.07
184 0.07
185 0.07
186 0.06
187 0.05
188 0.09
189 0.11
190 0.18
191 0.24
192 0.29
193 0.39
194 0.48
195 0.59
196 0.66
197 0.76
198 0.79
199 0.84
200 0.9
201 0.9
202 0.91
203 0.86
204 0.78
205 0.69
206 0.58
207 0.48
208 0.38
209 0.28
210 0.18
211 0.11
212 0.09
213 0.09
214 0.14
215 0.17
216 0.19
217 0.22
218 0.26
219 0.29
220 0.31
221 0.3
222 0.32
223 0.32
224 0.37
225 0.36
226 0.37
227 0.38
228 0.42
229 0.45
230 0.4
231 0.42
232 0.36
233 0.41
234 0.43
235 0.39
236 0.36
237 0.32
238 0.34
239 0.3
240 0.29
241 0.25
242 0.25
243 0.27
244 0.28
245 0.29
246 0.29
247 0.32
248 0.35
249 0.36
250 0.31
251 0.34
252 0.37
253 0.35
254 0.34
255 0.31
256 0.3
257 0.3
258 0.3
259 0.28
260 0.3
261 0.34
262 0.37
263 0.42
264 0.43
265 0.44
266 0.52
267 0.58
268 0.59
269 0.56
270 0.51
271 0.46
272 0.44
273 0.45
274 0.39
275 0.31
276 0.28
277 0.33
278 0.36
279 0.44
280 0.45
281 0.48
282 0.49
283 0.59
284 0.62
285 0.65
286 0.68
287 0.68
288 0.73
289 0.73
290 0.77
291 0.71
292 0.66
293 0.61
294 0.57
295 0.49
296 0.44
297 0.39
298 0.37
299 0.33
300 0.3
301 0.32
302 0.34
303 0.43
304 0.51
305 0.57
306 0.61
307 0.69
308 0.78
309 0.79
310 0.82
311 0.83
312 0.82
313 0.84
314 0.85
315 0.85
316 0.82
317 0.78
318 0.72
319 0.64
320 0.55
321 0.45
322 0.36
323 0.27
324 0.22
325 0.19
326 0.19
327 0.19
328 0.21
329 0.22
330 0.21
331 0.21