Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5VE12

Protein Details
Accession A0A2N5VE12    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-29LITRHGQRCRKAAKRRVLRPANCWHydrophilic
NLS Segment(s)
PositionSequence
35-45KKGKGKTAKRN
66-66K
Subcellular Location(s) nucl 16.5, mito_nucl 12.666, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
Amino Acid Sequences MRSFCLITRHGQRCRKAAKRRVLRPANCWILSTDKKGKGKTAKRNSRVTTKDDNVNAHHGRIKAAKKLQRLEKSHERNPTLASRISAHHQSDREILTRISGNTNDSSDYGKANSPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.78
4 0.78
5 0.8
6 0.82
7 0.85
8 0.87
9 0.87
10 0.82
11 0.77
12 0.77
13 0.74
14 0.64
15 0.55
16 0.46
17 0.43
18 0.42
19 0.43
20 0.42
21 0.41
22 0.45
23 0.45
24 0.51
25 0.53
26 0.59
27 0.64
28 0.66
29 0.7
30 0.72
31 0.8
32 0.77
33 0.76
34 0.7
35 0.65
36 0.62
37 0.55
38 0.53
39 0.47
40 0.45
41 0.37
42 0.41
43 0.35
44 0.27
45 0.27
46 0.22
47 0.21
48 0.25
49 0.26
50 0.25
51 0.32
52 0.36
53 0.39
54 0.45
55 0.53
56 0.56
57 0.57
58 0.59
59 0.63
60 0.66
61 0.66
62 0.67
63 0.6
64 0.52
65 0.52
66 0.48
67 0.41
68 0.35
69 0.3
70 0.24
71 0.24
72 0.27
73 0.3
74 0.28
75 0.3
76 0.29
77 0.3
78 0.32
79 0.32
80 0.3
81 0.26
82 0.23
83 0.21
84 0.23
85 0.22
86 0.22
87 0.21
88 0.22
89 0.22
90 0.23
91 0.22
92 0.2
93 0.23
94 0.19
95 0.2
96 0.19