Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5U8T9

Protein Details
Accession A0A2N5U8T9   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPWTSSRRRRRRNKTQPISPNLRPSLHydrophilic
NLS Segment(s)
PositionSequence
7-13RRRRRRN
Subcellular Location(s) mito 13.5, mito_nucl 12.833, nucl 11, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MPWTSSRRRRRRNKTQPISPNLRPSLLTHSILKELERVKPELDAISLRPANVMLWPFVHPDAPKNGGTPVRRLPDRDHWLARVRPLYPRQPVPSSSVPSSAPSATTIDRDHILPTPVRTAKVSKPLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.94
3 0.94
4 0.92
5 0.89
6 0.83
7 0.81
8 0.72
9 0.63
10 0.53
11 0.45
12 0.44
13 0.4
14 0.37
15 0.3
16 0.29
17 0.31
18 0.3
19 0.28
20 0.25
21 0.22
22 0.24
23 0.25
24 0.24
25 0.22
26 0.22
27 0.23
28 0.18
29 0.17
30 0.14
31 0.12
32 0.17
33 0.17
34 0.16
35 0.15
36 0.14
37 0.13
38 0.14
39 0.13
40 0.07
41 0.08
42 0.09
43 0.1
44 0.1
45 0.12
46 0.1
47 0.12
48 0.14
49 0.16
50 0.16
51 0.15
52 0.17
53 0.21
54 0.22
55 0.24
56 0.26
57 0.28
58 0.28
59 0.3
60 0.33
61 0.38
62 0.44
63 0.45
64 0.41
65 0.4
66 0.45
67 0.44
68 0.43
69 0.37
70 0.32
71 0.33
72 0.37
73 0.41
74 0.41
75 0.45
76 0.46
77 0.46
78 0.47
79 0.46
80 0.47
81 0.44
82 0.4
83 0.36
84 0.32
85 0.3
86 0.31
87 0.25
88 0.2
89 0.16
90 0.17
91 0.16
92 0.18
93 0.17
94 0.17
95 0.18
96 0.18
97 0.19
98 0.19
99 0.21
100 0.21
101 0.22
102 0.28
103 0.3
104 0.31
105 0.32
106 0.34
107 0.38