Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5SF82

Protein Details
Accession A0A2N5SF82    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-38TSLRKFLAAKPDRNEKKQKIEQESNTFIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 6, cyto 4, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000120  Amidase  
IPR020556  Amidase_CS  
IPR023631  Amidase_dom  
IPR036928  AS_sf  
IPR004412  GatA  
Gene Ontology GO:0030956  C:glutamyl-tRNA(Gln) amidotransferase complex  
GO:0005739  C:mitochondrion  
GO:0004040  F:amidase activity  
GO:0005524  F:ATP binding  
GO:0050567  F:glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity  
GO:0043864  F:indoleacetamide hydrolase activity  
GO:0070681  P:glutaminyl-tRNAGln biosynthesis via transamidation  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF01425  Amidase  
PROSITE View protein in PROSITE  
PS00571  AMIDASES  
Amino Acid Sequences MKTLRSLIRNTSLRKFLAAKPDRNEKKQKIEQESNTFITRFPPTEHVEHTTHPLPVLAGLAVAIKDIFCTRGTLTSCASAALDDFKPTYDAHVVSQLRKHGAKLVGKTNMDEFSMGSASTFSHYGKVRNPHGFCPQQQAMVEHRSAGGSSGGSAAAVAAGLCDIAIGSDTGGSIRLPGAYCGVPALKPSYGLISRFGMVQYSTSLDTVGILARSTDLIQKTFDCLSSYDQRDPTSIPITYRRKSAELNRLWQSRFACESEDLSNVRVGVPIEYFTSDLSEEVLSAFRATVDFLKQRGAQFVSVSLPSTGACLGAYYVLASAEASSNLARYSGLHFGRRSAVDRPSNTLDSAPPPSNLYAATRTEFFGEEVKRRLLLGAYTLSASGMKNYFLQAQKVRLAVRAEYDRVFRAPNVLMKTETAPPGSEEGVDVLLTPATLGSAPALEEDEAQRALAAAADSWSQDQLLVPASLAGIPALAIPVRLASPAPPGPPRSWPLAIQLIAQWGYEDTLFRLGSVLERMGSLEPVTSKKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.53
3 0.49
4 0.52
5 0.55
6 0.56
7 0.57
8 0.67
9 0.71
10 0.75
11 0.81
12 0.78
13 0.8
14 0.8
15 0.83
16 0.82
17 0.83
18 0.83
19 0.81
20 0.79
21 0.72
22 0.66
23 0.57
24 0.47
25 0.41
26 0.37
27 0.3
28 0.27
29 0.3
30 0.32
31 0.36
32 0.39
33 0.41
34 0.39
35 0.39
36 0.42
37 0.38
38 0.34
39 0.3
40 0.26
41 0.21
42 0.18
43 0.17
44 0.11
45 0.08
46 0.07
47 0.08
48 0.07
49 0.07
50 0.06
51 0.05
52 0.06
53 0.07
54 0.09
55 0.08
56 0.11
57 0.11
58 0.18
59 0.21
60 0.23
61 0.24
62 0.25
63 0.24
64 0.22
65 0.21
66 0.15
67 0.13
68 0.15
69 0.14
70 0.13
71 0.13
72 0.13
73 0.15
74 0.14
75 0.17
76 0.16
77 0.17
78 0.16
79 0.25
80 0.27
81 0.29
82 0.32
83 0.33
84 0.34
85 0.34
86 0.34
87 0.32
88 0.37
89 0.4
90 0.42
91 0.46
92 0.48
93 0.48
94 0.48
95 0.44
96 0.38
97 0.32
98 0.27
99 0.19
100 0.14
101 0.14
102 0.12
103 0.09
104 0.08
105 0.08
106 0.09
107 0.1
108 0.08
109 0.13
110 0.15
111 0.19
112 0.25
113 0.32
114 0.38
115 0.46
116 0.48
117 0.48
118 0.55
119 0.57
120 0.52
121 0.54
122 0.48
123 0.42
124 0.4
125 0.39
126 0.34
127 0.33
128 0.31
129 0.23
130 0.22
131 0.18
132 0.17
133 0.15
134 0.11
135 0.07
136 0.07
137 0.07
138 0.07
139 0.06
140 0.06
141 0.05
142 0.04
143 0.04
144 0.03
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.03
154 0.03
155 0.03
156 0.03
157 0.04
158 0.04
159 0.04
160 0.04
161 0.05
162 0.06
163 0.06
164 0.07
165 0.09
166 0.09
167 0.09
168 0.1
169 0.1
170 0.09
171 0.1
172 0.12
173 0.1
174 0.1
175 0.11
176 0.14
177 0.15
178 0.16
179 0.17
180 0.15
181 0.16
182 0.16
183 0.15
184 0.12
185 0.1
186 0.1
187 0.08
188 0.08
189 0.09
190 0.08
191 0.08
192 0.07
193 0.07
194 0.07
195 0.07
196 0.06
197 0.05
198 0.05
199 0.05
200 0.05
201 0.06
202 0.09
203 0.1
204 0.1
205 0.12
206 0.12
207 0.14
208 0.15
209 0.14
210 0.12
211 0.12
212 0.16
213 0.22
214 0.25
215 0.26
216 0.27
217 0.27
218 0.27
219 0.27
220 0.25
221 0.21
222 0.18
223 0.16
224 0.24
225 0.3
226 0.3
227 0.33
228 0.32
229 0.32
230 0.35
231 0.41
232 0.42
233 0.4
234 0.45
235 0.47
236 0.49
237 0.47
238 0.47
239 0.39
240 0.32
241 0.3
242 0.24
243 0.2
244 0.17
245 0.19
246 0.16
247 0.18
248 0.15
249 0.14
250 0.13
251 0.12
252 0.11
253 0.1
254 0.09
255 0.07
256 0.07
257 0.07
258 0.07
259 0.07
260 0.07
261 0.06
262 0.07
263 0.06
264 0.06
265 0.06
266 0.06
267 0.05
268 0.05
269 0.06
270 0.05
271 0.05
272 0.05
273 0.04
274 0.04
275 0.05
276 0.06
277 0.09
278 0.11
279 0.11
280 0.14
281 0.16
282 0.17
283 0.19
284 0.2
285 0.17
286 0.15
287 0.16
288 0.15
289 0.13
290 0.13
291 0.1
292 0.09
293 0.08
294 0.08
295 0.07
296 0.06
297 0.05
298 0.04
299 0.04
300 0.04
301 0.04
302 0.04
303 0.04
304 0.03
305 0.04
306 0.03
307 0.04
308 0.04
309 0.04
310 0.05
311 0.05
312 0.05
313 0.05
314 0.06
315 0.05
316 0.06
317 0.09
318 0.15
319 0.17
320 0.21
321 0.21
322 0.23
323 0.26
324 0.27
325 0.27
326 0.24
327 0.3
328 0.32
329 0.33
330 0.37
331 0.38
332 0.37
333 0.35
334 0.32
335 0.26
336 0.23
337 0.26
338 0.22
339 0.18
340 0.19
341 0.19
342 0.18
343 0.17
344 0.17
345 0.15
346 0.16
347 0.17
348 0.16
349 0.16
350 0.17
351 0.17
352 0.15
353 0.17
354 0.18
355 0.21
356 0.23
357 0.24
358 0.23
359 0.22
360 0.22
361 0.17
362 0.15
363 0.14
364 0.12
365 0.12
366 0.12
367 0.11
368 0.11
369 0.11
370 0.1
371 0.1
372 0.09
373 0.09
374 0.1
375 0.11
376 0.17
377 0.18
378 0.24
379 0.25
380 0.28
381 0.3
382 0.32
383 0.32
384 0.31
385 0.31
386 0.26
387 0.28
388 0.28
389 0.28
390 0.27
391 0.28
392 0.26
393 0.25
394 0.25
395 0.2
396 0.2
397 0.21
398 0.24
399 0.26
400 0.25
401 0.25
402 0.25
403 0.28
404 0.28
405 0.27
406 0.22
407 0.19
408 0.19
409 0.2
410 0.19
411 0.16
412 0.13
413 0.11
414 0.11
415 0.1
416 0.09
417 0.07
418 0.06
419 0.06
420 0.05
421 0.04
422 0.04
423 0.04
424 0.04
425 0.04
426 0.05
427 0.05
428 0.06
429 0.07
430 0.07
431 0.08
432 0.1
433 0.12
434 0.12
435 0.11
436 0.11
437 0.1
438 0.09
439 0.09
440 0.08
441 0.06
442 0.07
443 0.08
444 0.08
445 0.09
446 0.09
447 0.08
448 0.08
449 0.08
450 0.09
451 0.1
452 0.1
453 0.09
454 0.09
455 0.09
456 0.09
457 0.09
458 0.07
459 0.05
460 0.05
461 0.05
462 0.05
463 0.05
464 0.05
465 0.05
466 0.06
467 0.07
468 0.07
469 0.08
470 0.08
471 0.15
472 0.18
473 0.23
474 0.27
475 0.31
476 0.33
477 0.39
478 0.41
479 0.42
480 0.41
481 0.39
482 0.4
483 0.43
484 0.41
485 0.35
486 0.34
487 0.31
488 0.29
489 0.27
490 0.21
491 0.14
492 0.15
493 0.14
494 0.13
495 0.11
496 0.15
497 0.15
498 0.14
499 0.15
500 0.14
501 0.16
502 0.18
503 0.17
504 0.13
505 0.13
506 0.15
507 0.15
508 0.16
509 0.14
510 0.14
511 0.15