Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5S7V5

Protein Details
Accession A0A2N5S7V5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
55-80SQTNAQTQPKKKSRRKTKCTIVDNGEHydrophilic
NLS Segment(s)
PositionSequence
64-70KKKSRRK
Subcellular Location(s) nucl 14.5, cyto_nucl 8, mito 6, extr 3
Family & Domain DBs
Amino Acid Sequences MVLTTPVLFQATLTTKTSQEILQSRLNAWPAAIRTPITSNCTTKAAHLGAQEQPSQTNAQTQPKKKSRRKTKCTIVDNGELPEPTSTNPPDVTSASAPTTNETVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.23
4 0.25
5 0.2
6 0.23
7 0.24
8 0.25
9 0.28
10 0.29
11 0.29
12 0.3
13 0.31
14 0.24
15 0.2
16 0.19
17 0.15
18 0.16
19 0.16
20 0.14
21 0.14
22 0.17
23 0.19
24 0.21
25 0.23
26 0.22
27 0.23
28 0.25
29 0.23
30 0.21
31 0.23
32 0.19
33 0.18
34 0.17
35 0.18
36 0.19
37 0.2
38 0.21
39 0.16
40 0.16
41 0.14
42 0.15
43 0.12
44 0.15
45 0.16
46 0.25
47 0.32
48 0.37
49 0.46
50 0.54
51 0.65
52 0.68
53 0.75
54 0.78
55 0.82
56 0.85
57 0.85
58 0.87
59 0.87
60 0.85
61 0.81
62 0.75
63 0.69
64 0.62
65 0.53
66 0.44
67 0.34
68 0.29
69 0.22
70 0.17
71 0.13
72 0.17
73 0.16
74 0.17
75 0.18
76 0.18
77 0.2
78 0.21
79 0.24
80 0.2
81 0.22
82 0.21
83 0.23
84 0.22
85 0.22