Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5TZP7

Protein Details
Accession A0A2N5TZP7    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
62-97APAAKNTDHKTKRKPPKKKAPKKTVRQSKRVFELNGHydrophilic
NLS Segment(s)
PositionSequence
70-91HKTKRKPPKKKAPKKTVRQSKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.333, mito_nucl 13.166
Family & Domain DBs
Amino Acid Sequences MGLQEWEANVKVKTQQPPSQHPSSNKKMSDQTSIAFQLPPIPEATVVPGPPQASGSGSSHPAPAAKNTDHKTKRKPPKKKAPKKTVRQSKRVFELNGSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.44
3 0.49
4 0.57
5 0.63
6 0.64
7 0.64
8 0.64
9 0.65
10 0.68
11 0.69
12 0.61
13 0.58
14 0.57
15 0.55
16 0.53
17 0.46
18 0.37
19 0.33
20 0.33
21 0.3
22 0.23
23 0.19
24 0.18
25 0.17
26 0.16
27 0.13
28 0.11
29 0.11
30 0.11
31 0.14
32 0.1
33 0.1
34 0.09
35 0.1
36 0.1
37 0.1
38 0.1
39 0.08
40 0.08
41 0.1
42 0.11
43 0.11
44 0.13
45 0.13
46 0.13
47 0.13
48 0.13
49 0.12
50 0.13
51 0.17
52 0.17
53 0.24
54 0.27
55 0.38
56 0.44
57 0.51
58 0.58
59 0.64
60 0.73
61 0.76
62 0.84
63 0.85
64 0.89
65 0.93
66 0.94
67 0.95
68 0.95
69 0.95
70 0.95
71 0.95
72 0.95
73 0.93
74 0.93
75 0.9
76 0.88
77 0.85
78 0.82
79 0.73