Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5T5G9

Protein Details
Accession A0A2N5T5G9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
63-82KTKLCCPKNAEEFKKKNKDLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, E.R. 6, golg 3, vacu 2
Family & Domain DBs
Amino Acid Sequences MNSIILFKALLALAMVLEVQSYACPPNKKFGVCAKKNGDKKFSNPLNATGTQGSFDCKDPDAKTKLCCPKNAEEFKKKNKDLGALCREIETTVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.04
9 0.07
10 0.12
11 0.17
12 0.18
13 0.26
14 0.3
15 0.31
16 0.34
17 0.42
18 0.48
19 0.47
20 0.55
21 0.54
22 0.58
23 0.65
24 0.65
25 0.62
26 0.54
27 0.54
28 0.56
29 0.52
30 0.49
31 0.43
32 0.42
33 0.39
34 0.37
35 0.35
36 0.25
37 0.22
38 0.16
39 0.15
40 0.13
41 0.1
42 0.11
43 0.11
44 0.11
45 0.15
46 0.16
47 0.23
48 0.26
49 0.28
50 0.29
51 0.37
52 0.46
53 0.46
54 0.49
55 0.48
56 0.52
57 0.6
58 0.67
59 0.67
60 0.68
61 0.74
62 0.8
63 0.84
64 0.77
65 0.72
66 0.66
67 0.65
68 0.61
69 0.63
70 0.6
71 0.53
72 0.52
73 0.48
74 0.44