Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5SV42

Protein Details
Accession A0A2N5SV42    Localization Confidence High Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-37EKNSSRLMFKGEKKEKKKHKKRRRDERDTYGDTQGBasic
NLS Segment(s)
PositionSequence
12-26KGEKKEKKKHKKRRR
298-309ALKKARKEGRLA
315-318RRSK
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MSEKNSSRLMFKGEKKEKKKHKKRRRDERDTYGDTQGDSEPSEGWLNPPTQAHILGPLYMICVQPSYGNPIEAKPCALAIQPSPVSPIAKVVPAPLSAGALESLDPDDVNHVMVATRVIDSEEKVTLRTANGRYLAADQLGAVSAEQEARGPQEEWLLEPISQLAPIPDQPSGSAASPDPALEFSPDGLFALKSCLYNKYLTVEELANGKLDIRCDSDSPTDECSHILVRMQAVELVKAKKRLADERAKKGLSAKSNDSGLTILKPGQSFRDLEANNVRQYQARGAGRLELPAESKSALKKARKEGRLAEELLDRRSKIKSDRYAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.75
3 0.83
4 0.87
5 0.89
6 0.92
7 0.92
8 0.93
9 0.94
10 0.96
11 0.97
12 0.97
13 0.97
14 0.95
15 0.94
16 0.93
17 0.89
18 0.82
19 0.76
20 0.65
21 0.54
22 0.46
23 0.37
24 0.28
25 0.21
26 0.18
27 0.13
28 0.14
29 0.15
30 0.13
31 0.14
32 0.16
33 0.16
34 0.18
35 0.18
36 0.19
37 0.19
38 0.2
39 0.18
40 0.2
41 0.19
42 0.17
43 0.17
44 0.14
45 0.14
46 0.15
47 0.15
48 0.1
49 0.1
50 0.1
51 0.11
52 0.12
53 0.17
54 0.17
55 0.19
56 0.19
57 0.21
58 0.25
59 0.23
60 0.23
61 0.16
62 0.16
63 0.15
64 0.15
65 0.14
66 0.12
67 0.18
68 0.18
69 0.17
70 0.19
71 0.2
72 0.2
73 0.18
74 0.2
75 0.14
76 0.15
77 0.15
78 0.14
79 0.14
80 0.14
81 0.15
82 0.12
83 0.11
84 0.09
85 0.1
86 0.08
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.05
93 0.05
94 0.06
95 0.06
96 0.07
97 0.06
98 0.05
99 0.05
100 0.06
101 0.06
102 0.05
103 0.05
104 0.05
105 0.06
106 0.07
107 0.08
108 0.09
109 0.11
110 0.1
111 0.1
112 0.11
113 0.11
114 0.11
115 0.16
116 0.16
117 0.18
118 0.19
119 0.19
120 0.19
121 0.2
122 0.19
123 0.13
124 0.12
125 0.08
126 0.07
127 0.07
128 0.06
129 0.04
130 0.03
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.05
137 0.07
138 0.07
139 0.07
140 0.09
141 0.09
142 0.1
143 0.11
144 0.11
145 0.1
146 0.09
147 0.09
148 0.07
149 0.07
150 0.06
151 0.05
152 0.05
153 0.06
154 0.07
155 0.07
156 0.07
157 0.07
158 0.08
159 0.09
160 0.09
161 0.09
162 0.08
163 0.08
164 0.08
165 0.08
166 0.07
167 0.06
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.05
178 0.08
179 0.08
180 0.09
181 0.1
182 0.13
183 0.14
184 0.15
185 0.16
186 0.16
187 0.16
188 0.15
189 0.16
190 0.14
191 0.13
192 0.14
193 0.13
194 0.1
195 0.09
196 0.1
197 0.09
198 0.1
199 0.11
200 0.13
201 0.14
202 0.14
203 0.17
204 0.19
205 0.21
206 0.22
207 0.24
208 0.21
209 0.2
210 0.2
211 0.18
212 0.16
213 0.14
214 0.13
215 0.11
216 0.1
217 0.11
218 0.11
219 0.12
220 0.11
221 0.12
222 0.16
223 0.19
224 0.22
225 0.25
226 0.25
227 0.26
228 0.31
229 0.36
230 0.4
231 0.47
232 0.53
233 0.58
234 0.66
235 0.63
236 0.59
237 0.58
238 0.56
239 0.52
240 0.49
241 0.44
242 0.4
243 0.41
244 0.4
245 0.35
246 0.3
247 0.23
248 0.19
249 0.16
250 0.13
251 0.15
252 0.15
253 0.16
254 0.18
255 0.2
256 0.2
257 0.21
258 0.29
259 0.26
260 0.31
261 0.39
262 0.4
263 0.4
264 0.4
265 0.39
266 0.32
267 0.34
268 0.33
269 0.32
270 0.3
271 0.3
272 0.29
273 0.34
274 0.32
275 0.31
276 0.28
277 0.21
278 0.2
279 0.19
280 0.19
281 0.15
282 0.17
283 0.19
284 0.25
285 0.32
286 0.38
287 0.45
288 0.54
289 0.64
290 0.66
291 0.7
292 0.71
293 0.71
294 0.7
295 0.63
296 0.56
297 0.54
298 0.51
299 0.49
300 0.45
301 0.37
302 0.34
303 0.35
304 0.38
305 0.39
306 0.46