Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5W6R3

Protein Details
Accession A0A2N5W6R3    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
192-216EKLVPTYRGRPKKDEKPFIHPHELTBasic
NLS Segment(s)
Subcellular Location(s) mito 9, extr 7, mito_nucl 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008979  Galactose-bd-like_sf  
IPR013857  NADH-UbQ_OxRdtase-assoc_prot30  
IPR039131  NDUFAF1  
Pfam View protein in Pfam  
PF08547  CIA30  
Amino Acid Sequences MGTTLSLLIHTAFPGPTRPPQTAGRLQERALITDSWVIFGSSTRPWNIENWQEVSDRVRGGRSEGTLAYLHPSSRSEGVVFAGTLDSKTLGGAGFASQAYRQTIPLGTRGDHYTAFVLQVQPLEHAHFENNNNKNNNNNHVRTFTFVVSDRPRSDPTATTQSSLVYQFDFSLPFATPAAKLDHTILIRIPFEKLVPTYRGRPKKDEKPFIHPHELTQISFMARSFFDQQNGPFHLNILRLSIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.25
4 0.29
5 0.31
6 0.33
7 0.38
8 0.45
9 0.5
10 0.54
11 0.55
12 0.53
13 0.51
14 0.53
15 0.49
16 0.43
17 0.37
18 0.29
19 0.22
20 0.24
21 0.23
22 0.18
23 0.18
24 0.15
25 0.13
26 0.13
27 0.15
28 0.14
29 0.17
30 0.17
31 0.18
32 0.19
33 0.22
34 0.27
35 0.3
36 0.3
37 0.3
38 0.31
39 0.31
40 0.31
41 0.3
42 0.27
43 0.22
44 0.19
45 0.18
46 0.16
47 0.19
48 0.21
49 0.19
50 0.19
51 0.18
52 0.2
53 0.18
54 0.18
55 0.17
56 0.15
57 0.14
58 0.12
59 0.13
60 0.13
61 0.14
62 0.15
63 0.12
64 0.12
65 0.13
66 0.12
67 0.11
68 0.09
69 0.08
70 0.07
71 0.07
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.07
86 0.09
87 0.09
88 0.09
89 0.09
90 0.11
91 0.12
92 0.16
93 0.16
94 0.15
95 0.16
96 0.17
97 0.17
98 0.16
99 0.15
100 0.12
101 0.11
102 0.11
103 0.1
104 0.09
105 0.07
106 0.08
107 0.08
108 0.08
109 0.08
110 0.09
111 0.08
112 0.08
113 0.09
114 0.11
115 0.14
116 0.22
117 0.26
118 0.31
119 0.32
120 0.32
121 0.37
122 0.38
123 0.42
124 0.41
125 0.39
126 0.35
127 0.36
128 0.36
129 0.33
130 0.32
131 0.25
132 0.2
133 0.18
134 0.22
135 0.23
136 0.27
137 0.26
138 0.27
139 0.28
140 0.29
141 0.3
142 0.26
143 0.27
144 0.32
145 0.31
146 0.29
147 0.27
148 0.25
149 0.24
150 0.23
151 0.19
152 0.1
153 0.1
154 0.1
155 0.1
156 0.1
157 0.09
158 0.09
159 0.09
160 0.09
161 0.1
162 0.1
163 0.09
164 0.1
165 0.14
166 0.13
167 0.13
168 0.14
169 0.19
170 0.18
171 0.19
172 0.19
173 0.18
174 0.18
175 0.18
176 0.18
177 0.14
178 0.14
179 0.15
180 0.16
181 0.18
182 0.21
183 0.24
184 0.32
185 0.42
186 0.5
187 0.53
188 0.6
189 0.65
190 0.71
191 0.79
192 0.8
193 0.76
194 0.76
195 0.81
196 0.8
197 0.8
198 0.7
199 0.62
200 0.6
201 0.57
202 0.47
203 0.39
204 0.33
205 0.24
206 0.24
207 0.22
208 0.15
209 0.13
210 0.17
211 0.21
212 0.22
213 0.24
214 0.27
215 0.29
216 0.34
217 0.38
218 0.36
219 0.31
220 0.29
221 0.3
222 0.29
223 0.27