Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3P2I2

Protein Details
Accession J3P2I2    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-33ADAGNAKRRKARRLVSSRNKSCTTCHydrophilic
NLS Segment(s)
PositionSequence
14-21AKRRKARR
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
Amino Acid Sequences MPKRSSSPADAGNAKRRKARRLVSSRNKSCTTCLRMLANERSLDRLCQQDTNSKSKKCVYCCDTKKAGKDGQCTFAAGKVASASGVALVDAALELAEVREAQRDPAASLITRSEYGWASEFTAPKFPSGDATFVTWKAWLAKYEAKAHDTFVDACEAYKKSLENEDGGGGGGPSDELPAGLRDEHDSPDEDPAGLRYEYNSSDITEAQRDKTMGDIGTGVSLGLTALYRLSRGEVPLIPADDEAQFAAHVRHMGSLRSLLLYDKLASNAQDYLDRVRAAKDRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.61
4 0.64
5 0.66
6 0.68
7 0.69
8 0.74
9 0.81
10 0.84
11 0.89
12 0.88
13 0.86
14 0.81
15 0.72
16 0.67
17 0.65
18 0.62
19 0.55
20 0.52
21 0.48
22 0.48
23 0.54
24 0.55
25 0.5
26 0.46
27 0.41
28 0.42
29 0.39
30 0.37
31 0.32
32 0.31
33 0.29
34 0.29
35 0.31
36 0.34
37 0.38
38 0.46
39 0.51
40 0.47
41 0.49
42 0.54
43 0.58
44 0.55
45 0.59
46 0.55
47 0.58
48 0.62
49 0.66
50 0.66
51 0.65
52 0.66
53 0.63
54 0.63
55 0.58
56 0.59
57 0.55
58 0.51
59 0.46
60 0.42
61 0.35
62 0.31
63 0.27
64 0.19
65 0.16
66 0.11
67 0.1
68 0.09
69 0.08
70 0.06
71 0.04
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.02
80 0.02
81 0.02
82 0.02
83 0.03
84 0.03
85 0.03
86 0.06
87 0.07
88 0.08
89 0.09
90 0.1
91 0.1
92 0.11
93 0.12
94 0.09
95 0.1
96 0.1
97 0.1
98 0.1
99 0.1
100 0.1
101 0.1
102 0.11
103 0.11
104 0.1
105 0.12
106 0.14
107 0.15
108 0.14
109 0.19
110 0.18
111 0.18
112 0.18
113 0.15
114 0.16
115 0.17
116 0.17
117 0.12
118 0.14
119 0.15
120 0.14
121 0.15
122 0.11
123 0.1
124 0.11
125 0.12
126 0.1
127 0.13
128 0.16
129 0.19
130 0.25
131 0.26
132 0.26
133 0.25
134 0.25
135 0.23
136 0.2
137 0.18
138 0.12
139 0.12
140 0.1
141 0.09
142 0.12
143 0.11
144 0.11
145 0.11
146 0.11
147 0.11
148 0.15
149 0.16
150 0.14
151 0.15
152 0.14
153 0.13
154 0.13
155 0.11
156 0.07
157 0.05
158 0.04
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.04
165 0.05
166 0.06
167 0.06
168 0.06
169 0.09
170 0.1
171 0.11
172 0.12
173 0.13
174 0.13
175 0.15
176 0.15
177 0.13
178 0.12
179 0.11
180 0.13
181 0.12
182 0.11
183 0.09
184 0.12
185 0.13
186 0.15
187 0.14
188 0.12
189 0.14
190 0.15
191 0.16
192 0.19
193 0.19
194 0.18
195 0.2
196 0.2
197 0.18
198 0.19
199 0.2
200 0.14
201 0.14
202 0.13
203 0.1
204 0.1
205 0.1
206 0.08
207 0.05
208 0.05
209 0.04
210 0.04
211 0.03
212 0.03
213 0.04
214 0.05
215 0.06
216 0.06
217 0.09
218 0.1
219 0.12
220 0.15
221 0.15
222 0.19
223 0.21
224 0.22
225 0.2
226 0.18
227 0.19
228 0.15
229 0.14
230 0.11
231 0.09
232 0.08
233 0.08
234 0.09
235 0.09
236 0.1
237 0.1
238 0.14
239 0.15
240 0.16
241 0.17
242 0.18
243 0.18
244 0.18
245 0.18
246 0.15
247 0.16
248 0.16
249 0.16
250 0.15
251 0.16
252 0.17
253 0.18
254 0.18
255 0.18
256 0.17
257 0.19
258 0.19
259 0.23
260 0.25
261 0.26
262 0.24
263 0.28
264 0.35