Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5US10

Protein Details
Accession A0A2N5US10   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKVVKTHAKKKKVTVHNSNSESKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MAKVVKTHAKKKKVTVHNSNSESKAPDGHSKDENRSESESKQDPAVNVMDLTQDSNADNAKAIEKTSKKAQGPSVSEFDNVDQGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.81
4 0.82
5 0.81
6 0.76
7 0.68
8 0.6
9 0.52
10 0.41
11 0.35
12 0.28
13 0.31
14 0.3
15 0.3
16 0.34
17 0.35
18 0.39
19 0.43
20 0.41
21 0.36
22 0.38
23 0.37
24 0.32
25 0.34
26 0.31
27 0.25
28 0.25
29 0.24
30 0.19
31 0.19
32 0.18
33 0.13
34 0.1
35 0.1
36 0.09
37 0.08
38 0.08
39 0.06
40 0.06
41 0.06
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.09
48 0.09
49 0.1
50 0.17
51 0.19
52 0.23
53 0.31
54 0.39
55 0.39
56 0.44
57 0.51
58 0.52
59 0.55
60 0.56
61 0.51
62 0.45
63 0.43
64 0.39
65 0.33