Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5SXH5

Protein Details
Accession A0A2N5SXH5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAVSKSVKGQVRRRRREQRLKEASGTRTHydrophilic
NLS Segment(s)
PositionSequence
11-23VRRRRREQRLKEA
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MAVSKSVKGQVRRRRREQRLKEASGTRTTTKRSNVPRKASQKIVVISDSEHDGIECLNDSEDNGIVCLNDHMDDEIECLDDSKDDGIECLNGHKDDKIERLNDLPFYYITCPCLHTCLWDVRNVEAQHHLARAQNIYFAGGAVPLYDVRNCSRHEKPLRVLARASNKCFTSSSRFTSLSRGGSFLLKKRPKPASNVDPNPNQPNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.9
3 0.92
4 0.93
5 0.94
6 0.93
7 0.89
8 0.86
9 0.81
10 0.75
11 0.71
12 0.64
13 0.58
14 0.52
15 0.5
16 0.48
17 0.47
18 0.51
19 0.55
20 0.62
21 0.66
22 0.7
23 0.76
24 0.78
25 0.78
26 0.76
27 0.7
28 0.66
29 0.59
30 0.53
31 0.44
32 0.36
33 0.31
34 0.26
35 0.22
36 0.16
37 0.13
38 0.1
39 0.09
40 0.08
41 0.08
42 0.07
43 0.06
44 0.05
45 0.05
46 0.06
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.05
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.06
59 0.06
60 0.06
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.05
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.05
74 0.06
75 0.06
76 0.07
77 0.08
78 0.08
79 0.09
80 0.1
81 0.11
82 0.12
83 0.16
84 0.18
85 0.17
86 0.18
87 0.19
88 0.2
89 0.2
90 0.18
91 0.14
92 0.11
93 0.12
94 0.13
95 0.11
96 0.12
97 0.11
98 0.13
99 0.12
100 0.15
101 0.13
102 0.13
103 0.15
104 0.2
105 0.21
106 0.23
107 0.24
108 0.23
109 0.29
110 0.28
111 0.26
112 0.22
113 0.24
114 0.21
115 0.2
116 0.2
117 0.15
118 0.16
119 0.17
120 0.14
121 0.14
122 0.13
123 0.13
124 0.11
125 0.09
126 0.08
127 0.06
128 0.06
129 0.04
130 0.05
131 0.05
132 0.06
133 0.07
134 0.09
135 0.11
136 0.15
137 0.18
138 0.24
139 0.27
140 0.36
141 0.43
142 0.48
143 0.5
144 0.56
145 0.58
146 0.54
147 0.52
148 0.49
149 0.53
150 0.52
151 0.53
152 0.48
153 0.45
154 0.44
155 0.44
156 0.41
157 0.39
158 0.37
159 0.38
160 0.39
161 0.41
162 0.39
163 0.45
164 0.45
165 0.42
166 0.37
167 0.33
168 0.29
169 0.32
170 0.36
171 0.36
172 0.42
173 0.45
174 0.48
175 0.56
176 0.65
177 0.63
178 0.67
179 0.71
180 0.71
181 0.74
182 0.78
183 0.77
184 0.74
185 0.77