Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5TPH5

Protein Details
Accession A0A2N5TPH5   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
94-121NVWSHFNPSRQREKKKANCKYCQRMMSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 14, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003656  Znf_BED  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF02892  zf-BED  
PROSITE View protein in PROSITE  
PS50808  ZF_BED  
Amino Acid Sequences MPRTRLGKRAHPSTNSDDPGNKKEPTTTTTTRNLNSSDNNSDLKITGEAHSSTQTSTITRAPKNPSEKEKSAAPGSPKELEESTIKRTRKTTSNVWSHFNPSRQREKKKANCKYCQRMMSANPACGTKHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.61
3 0.56
4 0.52
5 0.5
6 0.52
7 0.5
8 0.43
9 0.35
10 0.36
11 0.37
12 0.35
13 0.38
14 0.35
15 0.36
16 0.42
17 0.46
18 0.43
19 0.42
20 0.4
21 0.36
22 0.36
23 0.35
24 0.32
25 0.3
26 0.3
27 0.27
28 0.25
29 0.22
30 0.19
31 0.15
32 0.13
33 0.11
34 0.12
35 0.12
36 0.12
37 0.13
38 0.13
39 0.11
40 0.11
41 0.11
42 0.09
43 0.11
44 0.14
45 0.18
46 0.19
47 0.24
48 0.27
49 0.33
50 0.39
51 0.42
52 0.45
53 0.47
54 0.47
55 0.45
56 0.43
57 0.4
58 0.35
59 0.33
60 0.29
61 0.25
62 0.26
63 0.26
64 0.24
65 0.23
66 0.21
67 0.2
68 0.21
69 0.21
70 0.25
71 0.3
72 0.3
73 0.31
74 0.33
75 0.36
76 0.4
77 0.43
78 0.45
79 0.47
80 0.56
81 0.57
82 0.59
83 0.56
84 0.55
85 0.55
86 0.52
87 0.51
88 0.48
89 0.57
90 0.61
91 0.68
92 0.72
93 0.78
94 0.82
95 0.84
96 0.88
97 0.87
98 0.88
99 0.9
100 0.9
101 0.88
102 0.83
103 0.76
104 0.72
105 0.66
106 0.67
107 0.61
108 0.55
109 0.47
110 0.44