Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5TEJ0

Protein Details
Accession A0A2N5TEJ0   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPPKKALKKKAPPKKPTRGQKPTKKAAEVSBasic
NLS Segment(s)
PositionSequence
3-25PKKALKKKAPPKKPTRGQKPTKK
Subcellular Location(s) nucl 18, mito_nucl 12.833, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MPPKKALKKKAPPKKPTRGQKPTKKAAEVSTNNDPAEKTTGHLKKDDYLVIIDWLKIKKNYDACFGTGKAPLVGRPPKGTINGFELMAINLRNQSTSKISLSSRQMKDCFNSYKDKYSCARHSTVTVSGYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.92
3 0.92
4 0.92
5 0.92
6 0.92
7 0.92
8 0.92
9 0.91
10 0.88
11 0.81
12 0.72
13 0.68
14 0.67
15 0.61
16 0.57
17 0.55
18 0.51
19 0.47
20 0.44
21 0.38
22 0.29
23 0.28
24 0.22
25 0.15
26 0.22
27 0.26
28 0.27
29 0.29
30 0.29
31 0.28
32 0.3
33 0.3
34 0.21
35 0.18
36 0.17
37 0.16
38 0.16
39 0.13
40 0.14
41 0.14
42 0.15
43 0.16
44 0.17
45 0.19
46 0.25
47 0.26
48 0.29
49 0.29
50 0.29
51 0.29
52 0.29
53 0.25
54 0.2
55 0.19
56 0.14
57 0.13
58 0.12
59 0.17
60 0.2
61 0.19
62 0.2
63 0.22
64 0.23
65 0.26
66 0.26
67 0.22
68 0.23
69 0.22
70 0.2
71 0.18
72 0.17
73 0.14
74 0.14
75 0.12
76 0.08
77 0.09
78 0.09
79 0.09
80 0.1
81 0.12
82 0.15
83 0.17
84 0.18
85 0.2
86 0.21
87 0.27
88 0.34
89 0.42
90 0.42
91 0.45
92 0.47
93 0.46
94 0.48
95 0.49
96 0.47
97 0.41
98 0.46
99 0.44
100 0.51
101 0.5
102 0.52
103 0.5
104 0.53
105 0.58
106 0.55
107 0.55
108 0.47
109 0.49
110 0.48
111 0.48