Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5S6H1

Protein Details
Accession A0A2N5S6H1   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
15-42IAARPKGVRTPPRTPKKRRAGAARLPTQHydrophilic
NLS Segment(s)
PositionSequence
17-38ARPKGVRTPPRTPKKRRAGAAR
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MGFCVTEGGTKGGLIAARPKGVRTPPRTPKKRRAGAARLPTQACKPPHALPRMPHAYKWREDSRLGVRPRRTGVLAMHSCLEGVQALHTLRTGVHGWHACPARLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.16
3 0.17
4 0.2
5 0.21
6 0.22
7 0.26
8 0.34
9 0.42
10 0.44
11 0.51
12 0.58
13 0.69
14 0.78
15 0.82
16 0.84
17 0.85
18 0.86
19 0.83
20 0.82
21 0.8
22 0.8
23 0.8
24 0.76
25 0.7
26 0.62
27 0.56
28 0.49
29 0.47
30 0.39
31 0.32
32 0.3
33 0.3
34 0.36
35 0.39
36 0.4
37 0.35
38 0.42
39 0.47
40 0.43
41 0.4
42 0.41
43 0.4
44 0.39
45 0.44
46 0.4
47 0.35
48 0.36
49 0.38
50 0.38
51 0.42
52 0.44
53 0.45
54 0.44
55 0.45
56 0.47
57 0.44
58 0.38
59 0.33
60 0.31
61 0.34
62 0.32
63 0.28
64 0.27
65 0.24
66 0.23
67 0.19
68 0.17
69 0.08
70 0.07
71 0.06
72 0.09
73 0.09
74 0.1
75 0.1
76 0.1
77 0.09
78 0.13
79 0.13
80 0.11
81 0.18
82 0.21
83 0.21
84 0.28
85 0.31