Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5SV07

Protein Details
Accession A0A2N5SV07    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
257-276ASSAAPRRDSRERSPPRRRRBasic
NLS Segment(s)
PositionSequence
261-276APRRDSRERSPPRRRR
Subcellular Location(s) nucl 8, extr 8, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010516  SAP18  
IPR042534  SAP18_sf  
Pfam View protein in Pfam  
PF06487  SAP18  
Amino Acid Sequences MADRSSRITTVDREKTCPFLLRVFVKPGSHHDLERHYQVPDRLPVSDECQLYAWKDTTLREICLQLLDSNPSIKSNLPLKFSIRLVYLDAPRDLGNSSHNAPLARYKSQDVGTIFCRDLARPASAAPTSSLKSLQDVRFCVGDLVDVALISSFSGTSSGGTSAPSDAARPGFSIRGAARGENPPDSASWGRSAAAPPRWGGPLPDRRSGGSGTFEASSHPHDHGRWGHNSVTYSERANGGAHRGNERYRDRGGPTWASSAAPRRDSRERSPPRRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.51
4 0.49
5 0.42
6 0.37
7 0.41
8 0.41
9 0.42
10 0.43
11 0.44
12 0.41
13 0.4
14 0.43
15 0.44
16 0.41
17 0.39
18 0.37
19 0.4
20 0.43
21 0.46
22 0.41
23 0.34
24 0.36
25 0.38
26 0.38
27 0.37
28 0.34
29 0.3
30 0.3
31 0.31
32 0.32
33 0.34
34 0.29
35 0.24
36 0.24
37 0.24
38 0.23
39 0.25
40 0.2
41 0.16
42 0.18
43 0.18
44 0.24
45 0.26
46 0.26
47 0.25
48 0.25
49 0.24
50 0.23
51 0.23
52 0.16
53 0.15
54 0.16
55 0.14
56 0.15
57 0.15
58 0.15
59 0.15
60 0.14
61 0.18
62 0.22
63 0.25
64 0.27
65 0.29
66 0.31
67 0.33
68 0.34
69 0.31
70 0.25
71 0.22
72 0.21
73 0.23
74 0.23
75 0.22
76 0.21
77 0.2
78 0.19
79 0.18
80 0.16
81 0.12
82 0.12
83 0.12
84 0.14
85 0.15
86 0.16
87 0.16
88 0.16
89 0.22
90 0.23
91 0.23
92 0.22
93 0.22
94 0.24
95 0.25
96 0.29
97 0.23
98 0.22
99 0.22
100 0.23
101 0.22
102 0.2
103 0.2
104 0.15
105 0.18
106 0.17
107 0.16
108 0.13
109 0.13
110 0.14
111 0.13
112 0.14
113 0.12
114 0.12
115 0.12
116 0.12
117 0.13
118 0.1
119 0.13
120 0.18
121 0.2
122 0.2
123 0.2
124 0.21
125 0.2
126 0.2
127 0.18
128 0.12
129 0.09
130 0.06
131 0.06
132 0.04
133 0.04
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.02
140 0.02
141 0.03
142 0.03
143 0.04
144 0.04
145 0.05
146 0.06
147 0.06
148 0.07
149 0.06
150 0.07
151 0.07
152 0.07
153 0.07
154 0.08
155 0.08
156 0.09
157 0.09
158 0.09
159 0.09
160 0.12
161 0.11
162 0.16
163 0.16
164 0.16
165 0.18
166 0.22
167 0.24
168 0.22
169 0.23
170 0.18
171 0.18
172 0.21
173 0.19
174 0.16
175 0.16
176 0.15
177 0.15
178 0.16
179 0.18
180 0.19
181 0.22
182 0.22
183 0.21
184 0.23
185 0.24
186 0.23
187 0.24
188 0.27
189 0.33
190 0.36
191 0.41
192 0.4
193 0.4
194 0.42
195 0.4
196 0.34
197 0.27
198 0.23
199 0.19
200 0.18
201 0.17
202 0.16
203 0.16
204 0.18
205 0.16
206 0.18
207 0.19
208 0.18
209 0.25
210 0.31
211 0.35
212 0.36
213 0.37
214 0.37
215 0.38
216 0.39
217 0.35
218 0.32
219 0.28
220 0.26
221 0.24
222 0.22
223 0.2
224 0.2
225 0.19
226 0.21
227 0.25
228 0.25
229 0.28
230 0.31
231 0.34
232 0.41
233 0.44
234 0.43
235 0.42
236 0.45
237 0.46
238 0.48
239 0.51
240 0.48
241 0.46
242 0.45
243 0.41
244 0.37
245 0.37
246 0.4
247 0.4
248 0.41
249 0.41
250 0.45
251 0.53
252 0.59
253 0.63
254 0.65
255 0.7
256 0.74