Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5W6J2

Protein Details
Accession A0A2N5W6J2    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-43TAQIQIPKRQTQNRPCPPRTKRPINQAKPIGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MCRRKRGLLAKTTAQIQIPKRQTQNRPCPPRTKRPINQAKPIGNAQGHCPAELPSTQTKPSAQNNSLELKSRKVTTDKPGDSNSLSTTTTQHSFHPTTPFPNIPIKLNHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.44
3 0.4
4 0.43
5 0.43
6 0.46
7 0.51
8 0.58
9 0.65
10 0.7
11 0.76
12 0.77
13 0.81
14 0.8
15 0.83
16 0.81
17 0.83
18 0.82
19 0.81
20 0.78
21 0.79
22 0.84
23 0.81
24 0.83
25 0.79
26 0.72
27 0.65
28 0.59
29 0.52
30 0.42
31 0.35
32 0.28
33 0.29
34 0.26
35 0.22
36 0.21
37 0.18
38 0.18
39 0.17
40 0.18
41 0.14
42 0.15
43 0.16
44 0.17
45 0.18
46 0.22
47 0.27
48 0.31
49 0.29
50 0.3
51 0.32
52 0.35
53 0.34
54 0.35
55 0.3
56 0.27
57 0.28
58 0.26
59 0.26
60 0.27
61 0.31
62 0.33
63 0.42
64 0.42
65 0.44
66 0.44
67 0.44
68 0.41
69 0.38
70 0.32
71 0.24
72 0.22
73 0.18
74 0.18
75 0.19
76 0.21
77 0.2
78 0.2
79 0.25
80 0.27
81 0.3
82 0.35
83 0.33
84 0.35
85 0.4
86 0.4
87 0.37
88 0.43
89 0.42
90 0.39