Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5T1A6

Protein Details
Accession A0A2N5T1A6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-25LAIAQRKKRVDKKVICDLLKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MWVPLLAIAQRKKRVDKKVICDLLKKTQAVGRVALAPPGPSLMDTPTDAPGGSQFLLLFRLLKPVWKCSVTLPAKARKSRKVASAWRSTAVPADTPAVPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.72
3 0.75
4 0.75
5 0.78
6 0.81
7 0.74
8 0.71
9 0.66
10 0.64
11 0.6
12 0.52
13 0.43
14 0.36
15 0.39
16 0.35
17 0.31
18 0.23
19 0.21
20 0.21
21 0.21
22 0.19
23 0.14
24 0.12
25 0.12
26 0.1
27 0.07
28 0.07
29 0.07
30 0.08
31 0.08
32 0.09
33 0.1
34 0.1
35 0.09
36 0.09
37 0.08
38 0.08
39 0.07
40 0.07
41 0.05
42 0.06
43 0.07
44 0.07
45 0.08
46 0.06
47 0.11
48 0.11
49 0.16
50 0.17
51 0.21
52 0.25
53 0.25
54 0.25
55 0.23
56 0.34
57 0.31
58 0.37
59 0.39
60 0.44
61 0.51
62 0.58
63 0.63
64 0.6
65 0.66
66 0.63
67 0.64
68 0.65
69 0.67
70 0.68
71 0.71
72 0.65
73 0.6
74 0.55
75 0.49
76 0.44
77 0.36
78 0.28
79 0.2
80 0.21