Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NI96

Protein Details
Accession J3NI96   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
76-100QSTKSSSSSEKRKRRSKESAGRSALHydrophilic
323-358ILAISVKRQRKLKMKKKKYKKLLKRTRNERRKLDRLBasic
NLS Segment(s)
PositionSequence
86-93KRKRRSKE
329-357KRQRKLKMKKKKYKKLLKRTRNERRKLDR
Subcellular Location(s) mito 17.5, mito_nucl 12.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLPSSARRVASAAPPSVFAGAVAVGLCLRPTASATSTTSSVGPRATRHQRRYSSSNPSSPDNDPENMSANRSLPAQSTKSSSSSEKRKRRSKESAGRSALAALPSVPSTQNLPRESLALSAFFSLHRPISITHSLPRAVSDDAFASIFARRGRSEKMNDVISALSQSVQELEQPMGGLNLGGQEGYPESGEGMPKISLKNPDGSDSGVYVQLNAMSGDFLPFCPPPIPEPKSEVTGVAEGTPTQVASRETTDPADQHGSEPRRRVYKAMLTIEETVESTGEVKYMAHSSELHEESTEPRRSFLERLARRQIMFQESQKRNGTILAISVKRQRKLKMKKKKYKKLLKRTRNERRKLDRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.32
4 0.28
5 0.19
6 0.13
7 0.09
8 0.09
9 0.07
10 0.06
11 0.06
12 0.06
13 0.06
14 0.05
15 0.05
16 0.05
17 0.07
18 0.11
19 0.12
20 0.16
21 0.19
22 0.21
23 0.22
24 0.23
25 0.23
26 0.21
27 0.21
28 0.21
29 0.2
30 0.21
31 0.3
32 0.4
33 0.49
34 0.56
35 0.64
36 0.69
37 0.74
38 0.78
39 0.77
40 0.76
41 0.74
42 0.71
43 0.64
44 0.61
45 0.58
46 0.53
47 0.51
48 0.44
49 0.38
50 0.34
51 0.32
52 0.33
53 0.29
54 0.29
55 0.25
56 0.22
57 0.21
58 0.2
59 0.2
60 0.17
61 0.22
62 0.22
63 0.22
64 0.25
65 0.27
66 0.28
67 0.3
68 0.33
69 0.35
70 0.44
71 0.52
72 0.58
73 0.66
74 0.73
75 0.78
76 0.82
77 0.84
78 0.85
79 0.85
80 0.85
81 0.85
82 0.8
83 0.72
84 0.62
85 0.53
86 0.44
87 0.34
88 0.24
89 0.14
90 0.1
91 0.1
92 0.11
93 0.09
94 0.08
95 0.12
96 0.16
97 0.23
98 0.23
99 0.25
100 0.25
101 0.25
102 0.25
103 0.23
104 0.19
105 0.13
106 0.12
107 0.1
108 0.1
109 0.09
110 0.1
111 0.1
112 0.09
113 0.09
114 0.09
115 0.1
116 0.16
117 0.2
118 0.2
119 0.22
120 0.24
121 0.24
122 0.23
123 0.23
124 0.19
125 0.16
126 0.15
127 0.12
128 0.1
129 0.1
130 0.1
131 0.09
132 0.08
133 0.07
134 0.1
135 0.1
136 0.12
137 0.12
138 0.14
139 0.18
140 0.24
141 0.27
142 0.29
143 0.32
144 0.31
145 0.3
146 0.29
147 0.25
148 0.19
149 0.15
150 0.1
151 0.07
152 0.06
153 0.05
154 0.05
155 0.05
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.05
163 0.05
164 0.04
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.04
173 0.04
174 0.03
175 0.04
176 0.05
177 0.05
178 0.05
179 0.06
180 0.07
181 0.08
182 0.09
183 0.11
184 0.14
185 0.15
186 0.2
187 0.2
188 0.22
189 0.22
190 0.22
191 0.2
192 0.16
193 0.16
194 0.13
195 0.12
196 0.09
197 0.08
198 0.08
199 0.08
200 0.07
201 0.06
202 0.04
203 0.04
204 0.05
205 0.05
206 0.05
207 0.07
208 0.07
209 0.09
210 0.1
211 0.1
212 0.13
213 0.22
214 0.25
215 0.25
216 0.29
217 0.3
218 0.32
219 0.31
220 0.28
221 0.21
222 0.19
223 0.17
224 0.13
225 0.11
226 0.08
227 0.09
228 0.08
229 0.06
230 0.06
231 0.07
232 0.08
233 0.1
234 0.13
235 0.14
236 0.15
237 0.17
238 0.19
239 0.18
240 0.2
241 0.21
242 0.18
243 0.18
244 0.25
245 0.29
246 0.31
247 0.36
248 0.37
249 0.41
250 0.41
251 0.43
252 0.41
253 0.44
254 0.49
255 0.49
256 0.46
257 0.43
258 0.43
259 0.41
260 0.34
261 0.26
262 0.18
263 0.12
264 0.1
265 0.08
266 0.07
267 0.06
268 0.06
269 0.06
270 0.07
271 0.09
272 0.09
273 0.1
274 0.11
275 0.13
276 0.21
277 0.22
278 0.21
279 0.2
280 0.2
281 0.23
282 0.31
283 0.35
284 0.28
285 0.28
286 0.3
287 0.33
288 0.35
289 0.39
290 0.41
291 0.41
292 0.49
293 0.57
294 0.59
295 0.56
296 0.58
297 0.55
298 0.51
299 0.49
300 0.49
301 0.5
302 0.5
303 0.57
304 0.57
305 0.53
306 0.47
307 0.43
308 0.37
309 0.27
310 0.28
311 0.29
312 0.26
313 0.29
314 0.37
315 0.42
316 0.46
317 0.51
318 0.55
319 0.58
320 0.68
321 0.75
322 0.78
323 0.82
324 0.87
325 0.93
326 0.95
327 0.96
328 0.96
329 0.96
330 0.96
331 0.96
332 0.96
333 0.95
334 0.96
335 0.96
336 0.95
337 0.94
338 0.94