Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5S9S1

Protein Details
Accession A0A2N5S9S1    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
51-76QPIRSGRKPTEKNQPPRKNPKTTYAFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 4, cyto 4, pero 3
Family & Domain DBs
Amino Acid Sequences MSYGAVDSCNTRVADTTQNKYGLYCTVQVRYWKNDEPLLAAGLPTPPALPQPIRSGRKPTEKNQPPRKNPKTTYAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.35
4 0.36
5 0.37
6 0.36
7 0.35
8 0.33
9 0.26
10 0.22
11 0.21
12 0.18
13 0.19
14 0.22
15 0.27
16 0.29
17 0.31
18 0.34
19 0.33
20 0.33
21 0.32
22 0.29
23 0.26
24 0.23
25 0.19
26 0.14
27 0.11
28 0.09
29 0.08
30 0.08
31 0.06
32 0.05
33 0.04
34 0.06
35 0.08
36 0.09
37 0.12
38 0.2
39 0.29
40 0.34
41 0.37
42 0.44
43 0.48
44 0.58
45 0.62
46 0.6
47 0.62
48 0.68
49 0.76
50 0.79
51 0.83
52 0.83
53 0.88
54 0.91
55 0.9
56 0.85