Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5U2I8

Protein Details
Accession A0A2N5U2I8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
194-218IIEGKPRKLRGKRFRRAPCKTLRPDBasic
NLS Segment(s)
PositionSequence
197-210GKPRKLRGKRFRRA
Subcellular Location(s) extr 8, mito 7, nucl 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
IPR017884  SANT_dom  
PROSITE View protein in PROSITE  
PS51293  SANT  
CDD cd00167  SANT  
Amino Acid Sequences MSQVQAVVPQVEAMIPKFVAMILQFVAMIPQVVAMAPQVEAFAKFIVSLNSSSDTHPQEMADAHHPRHGDPQSLGRARHRRLGRSHPVELRRDHLVADRHGHSDDKNNTLVTDPIAFYQLTPLKTESASSLPEISNWAAQEHEAFEKSYAAQPKQFGWIASQVKTRTPAECVIHYYRTKCENKYRNLHLPPQAIIEGKPRKLRGKRFRRAPCKTLRPDAAATNTLKPKPKTNPELPQTLGGDQPEATVLMNSRKPISMLILGNCLDSRSMQTSQANKTDSSTTTTTTTTHPSNKHLAVSRAELNKLSTRSAESNLPTIILTNQVPTAQFEPPMKPLDPHPASSTTLPPKLHEQQPPIHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.11
5 0.11
6 0.12
7 0.1
8 0.11
9 0.09
10 0.09
11 0.09
12 0.09
13 0.1
14 0.08
15 0.08
16 0.06
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.06
23 0.06
24 0.06
25 0.07
26 0.07
27 0.08
28 0.09
29 0.09
30 0.08
31 0.08
32 0.09
33 0.11
34 0.12
35 0.12
36 0.14
37 0.17
38 0.18
39 0.19
40 0.25
41 0.26
42 0.26
43 0.26
44 0.23
45 0.21
46 0.22
47 0.23
48 0.25
49 0.27
50 0.26
51 0.28
52 0.29
53 0.28
54 0.36
55 0.35
56 0.3
57 0.28
58 0.34
59 0.41
60 0.45
61 0.46
62 0.47
63 0.53
64 0.52
65 0.58
66 0.57
67 0.54
68 0.57
69 0.65
70 0.67
71 0.65
72 0.69
73 0.69
74 0.7
75 0.68
76 0.62
77 0.55
78 0.48
79 0.42
80 0.36
81 0.33
82 0.31
83 0.29
84 0.32
85 0.31
86 0.29
87 0.29
88 0.29
89 0.25
90 0.29
91 0.3
92 0.28
93 0.28
94 0.26
95 0.25
96 0.25
97 0.24
98 0.16
99 0.15
100 0.11
101 0.1
102 0.12
103 0.11
104 0.1
105 0.16
106 0.19
107 0.17
108 0.18
109 0.19
110 0.19
111 0.19
112 0.19
113 0.15
114 0.13
115 0.14
116 0.13
117 0.14
118 0.13
119 0.13
120 0.14
121 0.13
122 0.13
123 0.12
124 0.11
125 0.09
126 0.09
127 0.1
128 0.09
129 0.1
130 0.09
131 0.09
132 0.09
133 0.1
134 0.11
135 0.14
136 0.17
137 0.17
138 0.18
139 0.19
140 0.2
141 0.23
142 0.23
143 0.19
144 0.17
145 0.23
146 0.23
147 0.24
148 0.27
149 0.24
150 0.24
151 0.28
152 0.27
153 0.2
154 0.2
155 0.23
156 0.21
157 0.22
158 0.25
159 0.24
160 0.28
161 0.29
162 0.28
163 0.26
164 0.33
165 0.35
166 0.34
167 0.41
168 0.45
169 0.51
170 0.57
171 0.6
172 0.61
173 0.61
174 0.63
175 0.58
176 0.52
177 0.45
178 0.39
179 0.34
180 0.25
181 0.22
182 0.25
183 0.24
184 0.26
185 0.29
186 0.31
187 0.38
188 0.45
189 0.55
190 0.57
191 0.64
192 0.7
193 0.76
194 0.83
195 0.86
196 0.86
197 0.83
198 0.82
199 0.81
200 0.77
201 0.74
202 0.66
203 0.59
204 0.54
205 0.49
206 0.42
207 0.36
208 0.33
209 0.31
210 0.32
211 0.32
212 0.36
213 0.34
214 0.39
215 0.43
216 0.5
217 0.53
218 0.57
219 0.63
220 0.6
221 0.64
222 0.58
223 0.53
224 0.46
225 0.38
226 0.32
227 0.22
228 0.19
229 0.14
230 0.13
231 0.09
232 0.08
233 0.07
234 0.06
235 0.07
236 0.12
237 0.14
238 0.15
239 0.16
240 0.16
241 0.16
242 0.16
243 0.18
244 0.19
245 0.19
246 0.2
247 0.22
248 0.22
249 0.22
250 0.21
251 0.18
252 0.13
253 0.11
254 0.13
255 0.14
256 0.15
257 0.18
258 0.24
259 0.29
260 0.34
261 0.39
262 0.38
263 0.34
264 0.34
265 0.34
266 0.3
267 0.29
268 0.26
269 0.22
270 0.23
271 0.23
272 0.22
273 0.21
274 0.25
275 0.24
276 0.3
277 0.31
278 0.33
279 0.4
280 0.4
281 0.43
282 0.43
283 0.43
284 0.39
285 0.41
286 0.43
287 0.4
288 0.39
289 0.35
290 0.34
291 0.36
292 0.34
293 0.31
294 0.26
295 0.27
296 0.28
297 0.3
298 0.32
299 0.28
300 0.3
301 0.29
302 0.28
303 0.23
304 0.21
305 0.18
306 0.17
307 0.15
308 0.13
309 0.14
310 0.14
311 0.15
312 0.18
313 0.2
314 0.18
315 0.21
316 0.23
317 0.25
318 0.28
319 0.32
320 0.3
321 0.29
322 0.31
323 0.38
324 0.38
325 0.38
326 0.38
327 0.37
328 0.39
329 0.4
330 0.44
331 0.41
332 0.44
333 0.42
334 0.41
335 0.46
336 0.51
337 0.56
338 0.56
339 0.54