Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5VZJ9

Protein Details
Accession A0A2N5VZJ9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
92-120ARSPLTTTQKPPRKPKKPKQSHPPIAVNLHydrophilic
NLS Segment(s)
PositionSequence
88-111PKKHARSPLTTTQKPPRKPKKPKQ
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 2.5, mito 2
Family & Domain DBs
Amino Acid Sequences MAPRASLPPALSPEQSILSSEIQQITREEFNSNVSKAKSTMKALAALKLPKWLKDKIAEFSQEIEASKRVFEATGEIPKEEALKIHNPKKHARSPLTTTQKPPRKPKKPKQSHPPIAVNLLETDSSHSPEPDEEQTIVSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.21
4 0.18
5 0.17
6 0.18
7 0.19
8 0.2
9 0.19
10 0.2
11 0.2
12 0.21
13 0.21
14 0.21
15 0.2
16 0.17
17 0.21
18 0.24
19 0.24
20 0.24
21 0.22
22 0.23
23 0.23
24 0.28
25 0.27
26 0.26
27 0.3
28 0.27
29 0.32
30 0.32
31 0.33
32 0.32
33 0.3
34 0.27
35 0.3
36 0.29
37 0.28
38 0.31
39 0.3
40 0.29
41 0.34
42 0.36
43 0.33
44 0.36
45 0.33
46 0.29
47 0.29
48 0.27
49 0.21
50 0.19
51 0.16
52 0.13
53 0.12
54 0.11
55 0.09
56 0.08
57 0.07
58 0.07
59 0.08
60 0.1
61 0.14
62 0.15
63 0.15
64 0.15
65 0.15
66 0.16
67 0.13
68 0.11
69 0.09
70 0.16
71 0.24
72 0.3
73 0.32
74 0.36
75 0.43
76 0.5
77 0.54
78 0.55
79 0.53
80 0.53
81 0.57
82 0.64
83 0.66
84 0.62
85 0.61
86 0.63
87 0.66
88 0.68
89 0.73
90 0.74
91 0.75
92 0.83
93 0.88
94 0.89
95 0.92
96 0.94
97 0.94
98 0.94
99 0.93
100 0.9
101 0.87
102 0.78
103 0.71
104 0.61
105 0.51
106 0.4
107 0.31
108 0.23
109 0.16
110 0.18
111 0.15
112 0.17
113 0.17
114 0.16
115 0.16
116 0.18
117 0.22
118 0.21
119 0.23
120 0.21