Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5VK93

Protein Details
Accession A0A2N5VK93    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-85TTPTTITTRGKRPRRYRTRSKTAKSKPPQFHydrophilic
NLS Segment(s)
PositionSequence
64-82RGKRPRRYRTRSKTAKSKP
Subcellular Location(s) nucl 16, mito_nucl 12.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MPHYRPFIKTYCKIYPHGDEDDKTTKEPNTTIQTRFTNPESLNHNFISLSRKTQTTTPTTITTRGKRPRRYRTRSKTAKSKPPQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.53
4 0.53
5 0.49
6 0.41
7 0.43
8 0.46
9 0.41
10 0.36
11 0.33
12 0.28
13 0.26
14 0.26
15 0.26
16 0.27
17 0.3
18 0.3
19 0.33
20 0.34
21 0.35
22 0.37
23 0.33
24 0.31
25 0.27
26 0.3
27 0.29
28 0.29
29 0.3
30 0.27
31 0.25
32 0.2
33 0.2
34 0.21
35 0.16
36 0.17
37 0.16
38 0.17
39 0.18
40 0.21
41 0.25
42 0.25
43 0.28
44 0.28
45 0.3
46 0.31
47 0.36
48 0.4
49 0.41
50 0.45
51 0.52
52 0.58
53 0.65
54 0.73
55 0.79
56 0.83
57 0.87
58 0.89
59 0.9
60 0.92
61 0.92
62 0.91
63 0.91
64 0.9
65 0.91