Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5TZM7

Protein Details
Accession A0A2N5TZM7    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
88-113MRKYFKTKLSDQKKNRKPERQPPNLVHydrophilic
135-161KYLGAKFSAKKDRKKARQPCKIPVCANHydrophilic
NLS Segment(s)
PositionSequence
143-150AKKDRKKA
Subcellular Location(s) mito 11, nucl 6.5, cyto_nucl 6, cyto 4.5, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTPAIPSNSSSSNGPVPSPAPQKPFGQRESEVLVTTVVLGSPTAIAQPPTPSAYPKAKPGSLAPIPVFVILFVAAAMVFGWKTFNGKMRKYFKTKLSDQKKNRKPERQPPNLVVQSPPPTLECATGESLSGNMRKYLGAKFSAKKDRKKARQPCKIPVCANGETLDFENFKINIRPPRPETPPLKEPASCAKKREMTLLILEGKVAPPPPSPFLPLPPGLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.22
4 0.28
5 0.34
6 0.35
7 0.35
8 0.37
9 0.43
10 0.5
11 0.55
12 0.51
13 0.5
14 0.47
15 0.46
16 0.48
17 0.43
18 0.35
19 0.28
20 0.24
21 0.18
22 0.17
23 0.13
24 0.07
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.06
31 0.06
32 0.07
33 0.08
34 0.1
35 0.12
36 0.15
37 0.16
38 0.17
39 0.22
40 0.29
41 0.3
42 0.35
43 0.39
44 0.36
45 0.37
46 0.37
47 0.4
48 0.34
49 0.36
50 0.29
51 0.25
52 0.25
53 0.23
54 0.21
55 0.12
56 0.11
57 0.07
58 0.06
59 0.04
60 0.04
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.06
70 0.08
71 0.15
72 0.21
73 0.25
74 0.34
75 0.41
76 0.47
77 0.53
78 0.57
79 0.57
80 0.59
81 0.63
82 0.64
83 0.67
84 0.71
85 0.73
86 0.78
87 0.79
88 0.82
89 0.83
90 0.82
91 0.81
92 0.81
93 0.82
94 0.81
95 0.78
96 0.7
97 0.7
98 0.62
99 0.53
100 0.44
101 0.37
102 0.31
103 0.27
104 0.24
105 0.16
106 0.16
107 0.16
108 0.16
109 0.13
110 0.11
111 0.12
112 0.12
113 0.11
114 0.1
115 0.1
116 0.11
117 0.12
118 0.1
119 0.09
120 0.09
121 0.1
122 0.12
123 0.13
124 0.14
125 0.17
126 0.21
127 0.24
128 0.32
129 0.42
130 0.47
131 0.53
132 0.61
133 0.67
134 0.73
135 0.8
136 0.83
137 0.84
138 0.88
139 0.87
140 0.87
141 0.85
142 0.82
143 0.73
144 0.69
145 0.65
146 0.55
147 0.5
148 0.4
149 0.32
150 0.26
151 0.25
152 0.21
153 0.14
154 0.13
155 0.16
156 0.15
157 0.16
158 0.18
159 0.23
160 0.3
161 0.33
162 0.4
163 0.43
164 0.5
165 0.54
166 0.6
167 0.61
168 0.6
169 0.63
170 0.61
171 0.58
172 0.52
173 0.49
174 0.51
175 0.53
176 0.49
177 0.45
178 0.49
179 0.52
180 0.52
181 0.56
182 0.48
183 0.42
184 0.42
185 0.44
186 0.38
187 0.31
188 0.3
189 0.24
190 0.21
191 0.2
192 0.18
193 0.15
194 0.16
195 0.2
196 0.25
197 0.27
198 0.32
199 0.32
200 0.36
201 0.4