Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5VHT1

Protein Details
Accession A0A2N5VHT1    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-124TPTPSEKKTKNNTKTDNPKKKNPNWTIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MDLLPPTELLPDPPKVLGVDQNCHKLPTLAALASQASTCQITFSVNTLSTFSPRYCTADIYTIDIMSIPTPILDPLLEEMTSQTTQATSTNQSASATPTPSEKKTKNNTKTDNPKKKNPNWTIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.21
4 0.23
5 0.23
6 0.28
7 0.31
8 0.37
9 0.37
10 0.37
11 0.35
12 0.29
13 0.25
14 0.23
15 0.21
16 0.15
17 0.14
18 0.15
19 0.14
20 0.14
21 0.13
22 0.09
23 0.07
24 0.07
25 0.07
26 0.06
27 0.06
28 0.07
29 0.08
30 0.09
31 0.11
32 0.11
33 0.11
34 0.13
35 0.13
36 0.13
37 0.15
38 0.13
39 0.13
40 0.14
41 0.17
42 0.16
43 0.17
44 0.17
45 0.19
46 0.19
47 0.2
48 0.19
49 0.15
50 0.14
51 0.13
52 0.11
53 0.07
54 0.07
55 0.04
56 0.03
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.07
64 0.07
65 0.07
66 0.07
67 0.1
68 0.1
69 0.1
70 0.08
71 0.07
72 0.08
73 0.09
74 0.11
75 0.11
76 0.13
77 0.14
78 0.15
79 0.15
80 0.15
81 0.19
82 0.2
83 0.18
84 0.17
85 0.22
86 0.26
87 0.3
88 0.38
89 0.37
90 0.44
91 0.53
92 0.64
93 0.68
94 0.74
95 0.78
96 0.8
97 0.87
98 0.89
99 0.89
100 0.86
101 0.86
102 0.87
103 0.88
104 0.88