Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5VD78

Protein Details
Accession A0A2N5VD78    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-23RIRSLLQLIRKKKTRREEEEGIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MRIRSLLQLIRKKKTRREEEEGITAGINRSNTAARAVLEQLCSTGGRTDTVRPKREPTGRTDLSDRSRLVLCNRSQELIGQACPTRRQVLRSDSACPTTGRTRLFEHRSNCRVRPVNAGSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.8
4 0.81
5 0.8
6 0.76
7 0.74
8 0.66
9 0.56
10 0.45
11 0.37
12 0.28
13 0.22
14 0.16
15 0.1
16 0.1
17 0.11
18 0.11
19 0.12
20 0.13
21 0.11
22 0.13
23 0.15
24 0.15
25 0.15
26 0.14
27 0.12
28 0.12
29 0.12
30 0.1
31 0.1
32 0.09
33 0.09
34 0.1
35 0.16
36 0.25
37 0.33
38 0.37
39 0.38
40 0.41
41 0.47
42 0.53
43 0.49
44 0.46
45 0.48
46 0.45
47 0.44
48 0.43
49 0.4
50 0.37
51 0.39
52 0.32
53 0.25
54 0.24
55 0.24
56 0.25
57 0.27
58 0.25
59 0.28
60 0.28
61 0.27
62 0.26
63 0.25
64 0.26
65 0.2
66 0.2
67 0.15
68 0.16
69 0.17
70 0.19
71 0.2
72 0.22
73 0.22
74 0.25
75 0.29
76 0.34
77 0.41
78 0.41
79 0.43
80 0.41
81 0.42
82 0.4
83 0.34
84 0.32
85 0.3
86 0.33
87 0.31
88 0.31
89 0.34
90 0.42
91 0.49
92 0.51
93 0.52
94 0.57
95 0.63
96 0.67
97 0.64
98 0.65
99 0.65
100 0.6
101 0.63