Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5VGT8

Protein Details
Accession A0A2N5VGT8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-84SSSFPFSRVKHGRKKSPIGRSGKGHydrophilic
NLS Segment(s)
PositionSequence
68-90RVKHGRKKSPIGRSGKGSSKQVK
Subcellular Location(s) extr 9, mito 5.5, E.R. 5, plas 4, cyto_mito 3.5, golg 3
Family & Domain DBs
Amino Acid Sequences MFSRFVSFAFLACLSAVLGIASHTRSTSTEHRQVESNAEHTSGFENTELWSMYGTGGNDKSSSFPFSRVKHGRKKSPIGRSGKGSSKQVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.05
5 0.04
6 0.05
7 0.06
8 0.07
9 0.07
10 0.07
11 0.08
12 0.09
13 0.14
14 0.21
15 0.28
16 0.35
17 0.36
18 0.37
19 0.39
20 0.39
21 0.39
22 0.33
23 0.27
24 0.2
25 0.19
26 0.17
27 0.15
28 0.16
29 0.11
30 0.1
31 0.08
32 0.07
33 0.07
34 0.08
35 0.08
36 0.06
37 0.06
38 0.06
39 0.06
40 0.08
41 0.07
42 0.09
43 0.09
44 0.1
45 0.1
46 0.1
47 0.12
48 0.12
49 0.16
50 0.14
51 0.19
52 0.25
53 0.27
54 0.38
55 0.46
56 0.53
57 0.59
58 0.68
59 0.72
60 0.74
61 0.83
62 0.81
63 0.82
64 0.83
65 0.81
66 0.77
67 0.74
68 0.72
69 0.7
70 0.67