Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3NK43

Protein Details
Accession J3NK43    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
48-67RTSPERRSNKTKERVRRSESBasic
NLS Segment(s)
PositionSequence
46-75GPRTSPERRSNKTKERVRRSESWAPPPGKR
Subcellular Location(s) extr 13, nucl 5, mito 5, mito_nucl 5
Family & Domain DBs
Amino Acid Sequences MGAWQAPPLTVSQSAGALAQELAAALPALLLYLCATPRRSWIRGLGPRTSPERRSNKTKERVRRSESWAPPPGKRPSAVQATAGIKSALTHVITMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.09
5 0.08
6 0.07
7 0.05
8 0.05
9 0.04
10 0.04
11 0.04
12 0.03
13 0.03
14 0.02
15 0.03
16 0.02
17 0.03
18 0.03
19 0.04
20 0.05
21 0.08
22 0.1
23 0.1
24 0.17
25 0.23
26 0.24
27 0.25
28 0.29
29 0.36
30 0.41
31 0.45
32 0.42
33 0.38
34 0.39
35 0.43
36 0.41
37 0.37
38 0.39
39 0.44
40 0.46
41 0.53
42 0.6
43 0.64
44 0.7
45 0.74
46 0.76
47 0.78
48 0.82
49 0.79
50 0.77
51 0.75
52 0.75
53 0.73
54 0.71
55 0.68
56 0.63
57 0.6
58 0.61
59 0.59
60 0.52
61 0.48
62 0.43
63 0.42
64 0.46
65 0.44
66 0.38
67 0.38
68 0.37
69 0.37
70 0.34
71 0.27
72 0.18
73 0.17
74 0.17
75 0.15
76 0.12