Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N5W009

Protein Details
Accession A0A2N5W009    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
60-85ARFNQREKNCLRRRPNRVKASSPRGAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 6
Family & Domain DBs
Amino Acid Sequences MSDLVLGDETQRLVTTPPLSTVAWNNNLSCSLLSAAGSTSGPRDLVLVLKRCCFSCISAARFNQREKNCLRRRPNRVKASSPRGAPSGFTEPSADLLSPQSPNLFEPRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.14
4 0.16
5 0.19
6 0.19
7 0.2
8 0.24
9 0.26
10 0.29
11 0.3
12 0.28
13 0.26
14 0.26
15 0.25
16 0.2
17 0.16
18 0.11
19 0.09
20 0.09
21 0.08
22 0.08
23 0.08
24 0.08
25 0.07
26 0.07
27 0.07
28 0.07
29 0.06
30 0.07
31 0.06
32 0.1
33 0.14
34 0.19
35 0.2
36 0.22
37 0.23
38 0.23
39 0.24
40 0.21
41 0.18
42 0.18
43 0.23
44 0.25
45 0.3
46 0.31
47 0.36
48 0.39
49 0.41
50 0.42
51 0.38
52 0.39
53 0.39
54 0.48
55 0.51
56 0.57
57 0.64
58 0.66
59 0.76
60 0.81
61 0.87
62 0.86
63 0.84
64 0.83
65 0.83
66 0.82
67 0.77
68 0.68
69 0.61
70 0.53
71 0.47
72 0.38
73 0.34
74 0.32
75 0.26
76 0.25
77 0.24
78 0.22
79 0.23
80 0.24
81 0.18
82 0.12
83 0.14
84 0.16
85 0.16
86 0.16
87 0.16
88 0.15
89 0.17