Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N5W7X0

Protein Details
Accession A0A2N5W7X0   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MNILSTNKQRKQKIRWKGDRLCSLEGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 12.833, nucl 6, cyto_nucl 4.833
Family & Domain DBs
Amino Acid Sequences MNILSTNKQRKQKIRWKGDRLCSLEGFVTTLRDSYFLFGEINGWHDGKKVVILDNNTSGGKRRGKYRPSGSCGSGFKTHEHCYALFYVLHYLEPQIHCPPDPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.86
3 0.88
4 0.89
5 0.89
6 0.87
7 0.82
8 0.75
9 0.64
10 0.55
11 0.45
12 0.36
13 0.28
14 0.19
15 0.15
16 0.11
17 0.11
18 0.1
19 0.1
20 0.1
21 0.1
22 0.1
23 0.09
24 0.09
25 0.08
26 0.09
27 0.08
28 0.1
29 0.1
30 0.1
31 0.09
32 0.1
33 0.1
34 0.09
35 0.1
36 0.08
37 0.08
38 0.1
39 0.12
40 0.13
41 0.14
42 0.16
43 0.14
44 0.14
45 0.15
46 0.18
47 0.23
48 0.23
49 0.3
50 0.37
51 0.42
52 0.51
53 0.58
54 0.62
55 0.62
56 0.64
57 0.58
58 0.56
59 0.52
60 0.48
61 0.43
62 0.35
63 0.33
64 0.35
65 0.36
66 0.33
67 0.34
68 0.3
69 0.27
70 0.27
71 0.26
72 0.2
73 0.18
74 0.18
75 0.16
76 0.16
77 0.14
78 0.14
79 0.17
80 0.18
81 0.21
82 0.23
83 0.25